KEGG   Macaca fascicularis (crab-eating macaque): 102122119Help
Entry
102122119         CDS       T02918                                 

Gene name
MGAM2
Definition
(RefSeq) maltase-glucoamylase 2 (putative)
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf00052  Galactose metabolism
mcf00500  Starch and sucrose metabolism
mcf01100  Metabolic pathways
mcf04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    102122119 (MGAM2)
   00500 Starch and sucrose metabolism
    102122119 (MGAM2)
 09150 Organismal Systems
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    102122119 (MGAM2)
Enzymes [BR:mcf01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     102122119 (MGAM2)
    3.2.1.20  alpha-glucosidase
     102122119 (MGAM2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 102122119
NCBI-ProteinID: XP_015303644
LinkDB All DBs
Position
3
AA seq 2552 aa AA seqDB search
MARKLSVLEVLLIIFCLIVVVIDILLLLLVLEEPSDTSFTPECPDIPHSERIDCIPDQEV
TEDICRWQYKCCWSPVEDANVPRCFFPCNWGYEASNGHTNTSTGFTAQLKRLPSPSLFGN
DVATTLFTAEYQTSNRFHFKITDYNNIRYEVSHENIRLVDGTADASNLTYYVEVTDKPFS
IKIMRTSNRRVLLDTSIGPLQFAQQYLQLSFRLPSANVYGLGEHVHQQYRHNMTWKTWPI
FTRDATPTKDMINLYGAHTFFLCLEDASGSSFGVFLMNSNAMEVTLQPAPAITYRTIGGI
LDFYVFLGNTPEQVVQQYLELVGRPFLPPYWSLGFQLSRRDYGGINKLKEVVSRNRLAEI
PYDVQYSDIDYMDGKKDFTVDEVAYSGLPDFVKELHENGQKYVIIMNPGISKNSNYEPYN
NGSLKRVWILGNNGFAVGEGYPGPTVFPDYTNPVCTEWWIDQVAKFHDRLEFDGVWIEMN
EVASLLQASNDQCESNNLNFPPFLPRVLDHLLFARTLCMDTEFHGGLHYDIHSLYGHSMA
RTTNLALETVFMNNRSFILSRSTFAGSGQFAAHWLGDNAATWDDLRWSIPTILEFNLFGI
PMVGANICGYTNNVTEELCRRWMQLGAFYPLPRNHNGPGFRDQDPAAFGADSLLLSSSRH
YLNIRYTLLPYLYTLFYRAHTQGETVARPLVHEFYQDSATWDVHEQFLWGPGLLITPVLY
EGVDEVKAYIPDATWYDYETGVAIPWRKQLVNMLLAGDKIGLHLRGGYIFPTQKPNTTTE
ASRRNSLGLIIALDYKREAKGELYWDDGVSKDAVTEKKYILYDFSVTSNHLRAKIINNNY
TDTDNLMFTDITILGMDKQPANFTVLLNNVATSSPSVVYNASTKVVTITDLQGLVLGQEF
SIRWNLPVSDLEKFNCYPDDPTASEESCRQRGCLWEDTSTPGVPTCYYDTIPNYAASDIQ
YLSTSITADLSLLMASESAAAAAAAASDSLSAQISFLRLNVIYHTATMLQVKIYDPSNKR
YEVPVSLNTPPQPVGDPENRLYDVRIQNNPFGIQIQRKNSSTVIWDSQLPGFTFNDMFLS
ISTRLPSQYIYGFGETEHTTFRRNMTWNTWGMFARDEPPAYKKNSYGVHPYYMALEEDGS
AHGVLLLNSNAMDVTLQPTPALTYRTTGGILDFYIVLGPTPELVTQQYTELIGRPAMIPY
WALGFQLSRYGYENDAEISSLYDAMVAAQIPYDVQHVDIDYMNRKLDFTLSANFQNLSLL
IEQMKKNGMRFILILDPAISGNETQYLPFIRGQENNVFIKWPDTSDIVWGKVWPDLPNII
VDGSLDHATQVKLYKAYVAFPDFFRNSTAAWWKKEIEELYANPREPEKSLKFDGLWIDMN
EPSNFVDGSVRGCSDEMLNNPPYMPYLESRDNGLNSKTLCMESQQILPDGSPVKHYNVHS
LYGWSQTRPTYEAVQEVTGQRGVVITRSTFPSSGRWGGHWLGDNTAAWDQLGKSIIGMME
FSLFGIPYTGADICGFFGDAEYEMCVRWMQLGAFYPFSRNHNNIGTRRQDPVAWNSAFEM
LSRKVLETRYTLLPYLYTLMHKAHVEGSTVVRPLLHEFTDDRTTWDIDRQFMLGPAILIS
PVLETSTFEISAYFPRARWYDYSTGTSSQSTGQRKFLKAPLDHINLHVRGGYILPWQEPA
MNTHSSRQNFMGLTVALDDNGKAEGQMFWDDGQSIDTYENGNYFLANFIAAQNILQIQTI
HNKYLSDSNPLKVRYIRIWGVNSTYVTQVNFTYDNQQFMETNFTSDPHNQTLTIQLTNNT
INLEKLTEVIWIDGDPVLSTTTETSTISMSSHPSPSTTNATSSETITSSASANTTTGTTA
TVPITTTSFPTSTIGVTTNATVPNTTAPFLTNATASTNATVPITTTPFATSTTGVTTSTT
VPDTTAPFPTSTTTASTNATVPITTTPLATSTTGVTTSTIVPDTTAPFPTSTTTASTNAT
VPITTTLFETSTTGVTTSTTVPDTTAPFPTITTTASTNATVPITTAPLATSTTGVTTSTT
VPDTTAPFPTSTTTASTNATVPITTTPFATSTIGVTTSTTVPDTTAPFPTSSTGASTRAS
VPITTTPFPTNTADANTNNTVPNTTMPSPTGSTTVSTIATIPISVTPSLTSTADATISTT
VLIATTPSLTSTTDVSTSTTINDISTPFQTNTTNASTSTNVANITATSSHTSTDDTVPNN
TVPITAIPSFANTGVDTTSNSFSIMTTSFSENSNAMDSAVIMVTTSPTSADVASTNNDAS
VTNSLLATMSAGNTTSNSISITTTSFGNSVPIVTTPSPSTDATTTSNNSIPGMTTYYQTS
PTTPTHTLTPILSMFSTSNTFTTDKITNFTTPTNANTMIFNTLDTKSTMIIDAMVTTTST
KDNTISPDTTVTSTDKFTTHITQFTTPHSTTTTTLALSHTSLAPTNHSNLGTMDITDADN
SSSVTGNTTHISVSNITTVSDTITATGLDSQTPHMVTNSVASYLPITATSATKDTTSITK
YALNTTTPDSTVHTSATAPTYITNAINATQVP
NT seq 7659 nt NT seq  +upstreamnt  +downstreamnt
atggcaaggaagctcagtgtattggaagtccttctgatcatcttctgcctaattgtggtg
gtcatagatatcctcttgctgcttcttgtgttggaggaaccttcagatacttcatttact
ccagagtgcccagatattccccactcggaaaggatagactgcatacctgaccaggaggtg
accgaggatatctgcagatggcaatataagtgctgctggtcacctgtggaggatgccaat
gtccctaggtgcttcttcccctgtaactggggctatgaagccagcaatggccatacaaat
acaagcacaggatttactgcccagttgaaaaggttgccgtccccatctctgtttggaaat
gatgtcgccaccacccttttcacagctgaatatcagacatccaatcggtttcattttaag
atcactgactacaataacatacgctatgaagtttcccatgaaaatattaggctggttgat
gggactgctgatgcctccaatttgacctattatgtggaggttactgataaacctttcagc
atcaaaataatgaggacaagcaacagaagagtcttgttggacactagcatcgggcccctc
cagtttgcccagcagtacctgcaactgtctttccgactgcccagtgccaatgtgtatggg
ctgggagaacatgtgcaccagcagtaccgccacaacatgacctggaagacctggcccatc
ttcacccgggatgccacccccaccaaggacatgattaatctgtatggagctcatacattc
ttcttgtgccttgaagacgccagtggctcctcttttggagtttttctgatgaacagtaat
gccatggaggttacccttcagccagctcctgcaatcacttatcgcacgattggaggcatt
cttgacttctatgtattcctaggaaacactccagaacaagtggttcagcaatacttggag
cttgttggacggccattcttgcctccctattggagtcttgggttccagcttagtcgcagg
gattatggtggcatcaataaattgaaagaagttgtaagccgaaatcgtttagctgagata
ccatatgacgtccagtactctgacatagactacatggatggaaagaaggatttcactgtt
gatgaagtcgcttactctggtctcccagattttgtcaaggagttacatgaaaatggacag
aaatatgttattattatgaatcctggcatctccaaaaactctaactacgagccctataat
aatggaagcctaaagagagtgtggatcttggggaacaatggctttgctgttggggaggga
tatccgggaccgacagtctttcccgattataccaatccagtatgcactgagtggtggata
gatcaggttgctaaatttcatgatcgtctggagtttgatggagtgtggattgaaatgaat
gaagttgctagcttactccaagcttctaatgaccagtgtgaatccaacaacttgaacttt
cctccttttcttcctagagttctggatcacttactttttgcaagaactctctgcatggac
acggagtttcatggaggccttcactatgacatccacagcttgtatggccactccatggca
agaaccacaaacttagccctggagaccgtcttcatgaataataggagcttcatcttatcc
cgttcaacttttgctggatctggccaatttgctgctcattggctgggggacaatgcggcc
acatgggatgacctccgatggtcaatccccactatccttgagttcaacctgtttggcatc
cctatggtaggtgccaacatctgtggttataccaacaatgtcacagaggagctctgcaga
aggtggatgcagcttggagcattttatccactaccaaggaatcacaatgggcctgggttc
agggaccaggatcctgctgcctttggtgctgattccctgctgctgagttcctccagacat
tatctgaacatccgctacaccttgctgccctatctctatacccttttctaccgtgctcac
acccagggagagacggtggcaaggccccttgtacatgagttctaccaggactcagccacg
tgggatgtgcatgagcagttcttatggggacctggactcctcatcacgcctgttttatat
gaaggtgtggacgaagtgaaagcatacatacctgatgccacctggtatgactatgagaca
ggagtggccatcccgtggaggaagcagttggtgaatatgcttctcgcaggtgataagata
ggacttcatctgcgagggggctacatatttcccactcagaagccgaacacaaccacagaa
gccagccggaggaattccctgggactcatcatcgccttggactataagagagaagcgaag
ggggagctgtactgggatgacggtgtatctaaagatgctgtaactgaaaagaagtatatt
ctatatgatttctctgttacctctaaccatctacgagcaaagattataaataataattat
acggacactgacaacctcatgtttacagatatcacaatcttgggaatggacaaacagcca
gctaattttaccgtcttactgaataatgtcgccacctccagtccaagcgttgtctacaat
gcttccacaaaggtggtaaccatcactgatctccaaggactggtactgggacaagaattc
tctattaggtggaatcttcctgtcagtgacctggagaaattcaactgctaccctgacgat
ccaacagcctctgaggagagttgtcggcagcgggggtgtctttgggaggacacatctact
cctggagtgcccacctgttactatgacaccatccctaattatgctgctagtgacattcag
tatctgagcaccagcatcactgcagacctttccctcctgatggcctctgagtcagctgct
gctgctgctgctgctgcctctgattctctctctgcacagatcagcttcctccgcctgaat
gtgatctatcacacagcaaccatgctgcaggtcaagatctatgaccccagtaataaaagg
tatgaggttccagtatcactgaacacccctccccaaccagttggtgaccctgaaaaccgt
ttgtatgatgtcaggattcagaacaatccttttggaatccagatccaacgcaaaaactcc
agcactgtgatttgggattctcaactccctggcttcaccttcaatgacatgtttctctcc
atttctacgcgtctgccctctcagtacatctatggctttggggaaactgagcacacgact
ttcagaagaaacatgacctggaacacatgggggatgtttgctcgcgatgagccacctgcg
tacaagaagaattcctatggtgtccacccttactacatggcactggaggaggatggtagt
gcccatggagtgctcctgctaaatagcaatgccatggatgtgacattacagcccacccct
gccctgacataccgcaccaccggaggaattttggacttctacattgttttggggccaacc
cctgaacttgtaactcagcaatacaccgagttgatcggtcggccagcaatgattccatac
tgggccttgggattccagttgagtcgctatggatacgagaatgatgctgaaatctccagt
ttgtatgatgcaatggtggcagcccagattccctatgacgtccagcatgtagacattgat
tacatgaaccggaagctggatttcaccctcagtgccaactttcaaaacctcagtcttctg
attgagcaaatgaagaaaaatggcatgagatttattctcattttggacccagccatttct
ggcaatgagacacagtatctcccattcattagaggacaggaaaataacgtgttcatcaaa
tggcctgacaccagtgacattgtctgggggaaggtttggccagatctgcctaatataatt
gtagatggatcccttgaccatgcaactcaggttaagctctacaaggcctacgttgccttt
cctgacttctttcgtaatagcacagctgcgtggtggaagaaagagatagaagagctctat
gcaaaccctcgagaaccagagaagagcctgaagtttgatggattgtggattgatatgaat
gagccatcaaactttgtggatggatctgtcaggggctgcagcgatgaaatgctaaataac
ccaccctatatgccatatttggaatctagggacaacggcctgaacagcaagaccctgtgc
atggagagtcagcagatcctgccagacggctcccctgtgaaacactacaatgtgcacagc
ctgtacgggtggtcccagaccagacccacatacgaagctgtgcaggaggtgacaggacag
cgaggggtcgtcatcacccgctccacatttccctcttctggacgctggggaggacactgg
ctgggagacaatacagctgcgtgggaccagctggggaaatctatcattggcatgatggag
ttcagtctctttggaataccttatacaggagcagatatctgtgggttctttggagatgct
gaatatgagatgtgtgttcgctggatgcagctgggggcattttatccattttccagaaac
cacaacaacatcgggacaaggagacaagatcctgtggcctggaattcagcctttgagatg
ttatccagaaaagtcctagagaccagatacaccctgcttccttatctctatactctgatg
cataaagctcacgttgagggcagcactgttgtccgaccccttctccatgagtttacggat
gacaggacaacatgggatatagaccgtcagttcatgttgggtcctgctatcttaatcagc
cctgtgttggaaactagcacatttgagatctctgcttattttccgagagcccgttggtat
gactatagcacgggaactagcagccaatcaacaggtcagaggaaattcctgaaggctccc
cttgaccacatcaaccttcatgtcagaggaggctacatcctgccctggcaagagcctgca
atgaacactcactccagtcgacagaattttatgggattgactgttgctttggatgacaat
gggaaagctgaaggccagatgttctgggatgatggacaaagcattgatacctatgaaaat
ggaaattattttttggcaaactttatagcagctcagaacatcctgcaaatccagaccata
cacaataaatatttgagtgactcgaatccactaaaagttagatatattagaatctggggt
gtgaactctacttatgtgacacaagtcaatttcacctatgacaaccagcaatttatggag
acaaatttcacgagtgaccctcataatcagacactaactattcaattgactaacaacact
atcaacctggaaaagttaactgaggttatttggattgatggtgatcctgtactttccact
acaactgagacaagcaccatctcaatgagttctcatccttctccatctactaccaatgcc
accagttctgagacaatcaccagttctgccagtgcaaataccaccactggcactactgct
actgttcccatcacaaccacatctttcccaacaagtactattggtgttacaactaatgct
actgttcccaatacgactgcccctttcctgacaaatgctactgctagcactaatgctact
gttcctatcacaaccacaccttttgcaacaagtactactggtgttacaactagtactact
gttcctgatacaactgctcctttccctacaagtactactactgctagcactaatgctact
gttcctatcacaaccacacctttggcaacaagtactactggtgttacaactagtactatt
gttcctgatacgactgctcctttccctacaagtactactactgctagcactaatgctact
gttcctatcacaaccacactttttgaaacaagtactactggtgttacaactagtactact
gttcctgatacgactgctcctttccctacaattactactactgctagcactaatgctact
gttcccatcacaaccgcacctttggcaacaagtactactggtgttacaactagtactact
gttcctgatacgactgctcctttccctacaagtactactactgctagcactaatgctact
gttcccatcacaaccacaccttttgcaacaagtactattggtgttacaactagtactact
gttcctgatacaactgctcctttccctacaagtagtactggtgctagcactagggctagt
gttcctattacaaccacacctttccctacaaatactgcagatgctaacactaataatact
gttcctaataccactatgccttctcctacaggtagtactactgtgagtactattgctacc
attcccatttcagtgactccttctctgacaagtactgctgatgccaccattagtactact
gtacttattgccactactccttctctaacaagtactactgatgttagcactagtactact
attaatgatataagtactccttttcaaacaaatactactaatgctagcactagtactaat
gttgctaatataactgctacctcctctcatacaagtactgatgatactgttcctaataat
actgttccaattacagctattccttcttttgcaaatactggtgttgacactactagcaac
agtttttctattatgaccacttctttctctgaaaatagtaatgctatggactctgctgtt
attatggtaaccacttctcctacaagtgctgatgttgctagcacaaataatgatgcttct
gtgacaaattctcttttagctacaatgtctgctggtaatacaactagtaatagtatttcc
ataacaactacttcttttggtaatagtgttcctattgtgactactccttctccaagtact
gatgctactactacaagtaataatagtattcctggcatgactacttattaccaaacttct
cctaccactcctacccatactcttactcctattttgagcatgttttcaacaagtaataca
ttcactactgataaaattactaattttactacccctacaaatgcaaacaccatgattttc
aacactcttgatacaaaaagtaccatgataatagatgctatggtcactactaccagcacc
aaagataataccataagtccagatacaacagttacttccacagacaaattcaccacacac
atcacacagttcactactccccattctactactactacaacactggccttaagccacaca
tcattagctcctacaaatcattctaatctaggcaccatggatattactgatgcagataac
tccagcagtgttacaggtaacactacacacatttccgtttcaaatatcacaacagtctca
gacacaataacagctactggtctagattcacagactccccacatggtaacaaattctgtg
gctagttatttacctattactgcaactagtgctaccaaagatactacaagtattacaaaa
tatgctttaaatactaccactcctgatagtacagtacatacctctgctactgcacctact
tatattacaaatgccataaatgctactcaagttccatga

DBGET integrated database retrieval system