KEGG   Macaca fascicularis (crab-eating macaque): 102122135Help
Entry
102122135         CDS       T02918                                 

Gene name
ALDH2
Definition
(RefSeq) aldehyde dehydrogenase 2 family (mitochondrial)
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf00010  Glycolysis / Gluconeogenesis
mcf00053  Ascorbate and aldarate metabolism
mcf00071  Fatty acid degradation
mcf00280  Valine, leucine and isoleucine degradation
mcf00310  Lysine degradation
mcf00330  Arginine and proline metabolism
mcf00340  Histidine metabolism
mcf00380  Tryptophan metabolism
mcf00410  beta-Alanine metabolism
mcf00561  Glycerolipid metabolism
mcf00620  Pyruvate metabolism
mcf01100  Metabolic pathways
Module
mcf_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    102122135 (ALDH2)
   00053 Ascorbate and aldarate metabolism
    102122135 (ALDH2)
   00620 Pyruvate metabolism
    102122135 (ALDH2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    102122135 (ALDH2)
   00561 Glycerolipid metabolism
    102122135 (ALDH2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    102122135 (ALDH2)
   00310 Lysine degradation
    102122135 (ALDH2)
   00330 Arginine and proline metabolism
    102122135 (ALDH2)
   00340 Histidine metabolism
    102122135 (ALDH2)
   00380 Tryptophan metabolism
    102122135 (ALDH2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    102122135 (ALDH2)
Enzymes [BR:mcf01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     102122135 (ALDH2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh HetR_C
Motif
Other DBs
NCBI-GeneID: 102122135
NCBI-ProteinID: XP_005572335
LinkDB All DBs
Position
11
AA seq 557 aa AA seqDB search
MLRAAARFGPRLGLRFLSAAATQAVPAPNQQPEVFCNKDFSSQKPGLGCWTSSAGVARAV
SESLWNAWVNESQLLQNKIFINNEWHNAVSRKTFPTVNPSTGEVICQVAEGDKEDVDKAV
KAARAAFQLGSPWRRMDASHRGRLLNRLADLIERDRTYLAALETLDNGKPYVTSYLVDLD
MVLKCLRYYAGWADKYHGKTIPIDGDFFSYTRHEPVGVCGQIIPWNFPLLMQAWKLGPAL
ATGNVVVMKVAEQTPLTALYVANLIKEAGFPPGVVNIVPGFGPTAGAAIASHEDVDKVAF
TGSTEIGRLIQVAAGSSNLKRVTLELGGKSPNIIMSDADMDWAVEQAHFALFFNQGQCCC
AGSRTFVQEDIYDEFVERSVARAKSRVVGNPFDSKTEQGPQVDETQFKKILGYINTGKQE
GAKLLCGGGIAADRGYFIQPTVFGDVQDGMTIAKEEIFGPVMQILKFKTIEEVVGRANNS
TYGLAAAVFTKDLDKANYLSQALQAGTVWVNCYDVFGAQSPFGGYKMSGSGRELGEYGLQ
AYTEVKTITVKVPQKNS
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atgttgcgtgctgccgcccgcttcgggccccgcctgggcctccgcttcttgtcagccgcc
gccacccaggccgtgcccgcccccaaccagcagcccgaggtcttctgcaacaaggacttc
agctcccagaagccaggacttggctgttggacttccagtgctggagtggccagggctgtc
agtgaaagcttatggaatgcgtgggtgaatgaatctcaacttttacaaaacaaaatcttc
ataaacaatgaatggcacaatgccgtcagcaggaaaacattccccacagtcaatccgtcc
actggagaggtcatctgccaggtagctgaaggggacaaggaagatgtggacaaggcagtg
aaggccgcccgggccgccttccagctgggctcaccttggcgtcgcatggacgcgtcacac
aggggccggctgctgaaccggctggctgatctgatcgagcgggaccggacctacctggcg
gccttggagactctggacaatggcaaaccctatgtcacctcctacctggtggatttggac
atggtcctcaaatgtctccggtattatgccggctgggctgataagtaccacgggaaaacc
attcccattgacggagacttcttcagctacacccgccatgaacctgtgggggtgtgcggg
cagatcattccgtggaatttcccactcctgatgcaagcatggaagctgggcccagccttg
gcgactggaaacgtggttgtgatgaaggtagctgagcagacacccctcactgccctctat
gtggccaacctgatcaaggaggccggctttccccctggtgtggtcaacattgttcctgga
tttggccccacagccggggccgccatcgcctcccatgaggatgtggacaaagtggcattc
acaggctccaccgagattggccgcctcatccaggttgctgccgggagcagcaatctcaag
agagtgaccttggagctggggggaaagagccccaacatcatcatgtcagatgccgacatg
gactgggccgtggagcaggcccacttcgccctgttcttcaaccagggccaatgctgctgt
gctggctcccggaccttcgtgcaggaggacatctatgacgagtttgtggagcggagcgtt
gcccgggccaagtctcgggtggtcgggaacccctttgacagcaagaccgagcaggggccg
caggtggatgaaactcagtttaagaagatcctcggctacatcaacactgggaaacaagag
ggggcgaagctgctgtgtggtgggggcattgctgctgaccgtggttacttcatccagccc
accgtgtttggagatgtgcaggatggcatgaccatcgccaaggaggagatcttcgggcca
gtgatgcagatcctgaagttcaagaccatagaggaagttgttgggagagccaacaattcc
acgtacgggctggccgcagctgtcttcacaaaggatttggacaaggccaattacctgtcc
caggccctccaggcgggcaccgtgtgggtcaactgctatgatgtgtttggagcccagtca
ccctttggcggctacaagatgtcgggcagtggccgggagctgggcgagtacggcctgcag
gcatacactgaagtgaaaactatcacagtcaaagtgcctcagaagaactcataa

DBGET integrated database retrieval system