KEGG   Macaca fascicularis (crab-eating macaque): 102122741Help
Entry
102122741         CDS       T02918                                 

Gene name
ERG
Definition
(RefSeq) ERG, ETS transcription factor
  KO
K09435  transcriptional regulator ERG
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf05202  Transcriptional misregulation in cancer
mcf05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    102122741 (ERG)
  09162 Cancer: specific types
   05215 Prostate cancer
    102122741 (ERG)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mcf03000]
    102122741 (ERG)
Transcription factors [BR:mcf03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters Ets-type
    102122741 (ERG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ets SAM_PNT SAM_3 SAM_2 SAM_1 Arb2
Motif
Other DBs
NCBI-GeneID: 102122741
NCBI-ProteinID: XP_005548743
UniProt: A0A2K5UZL3
LinkDB All DBs
Position
3
AA seq 486 aa AA seqDB search
MIQTVPDPAAHIKEALSVVSEDQSLFECAYGTPHLAKTEMTASSSSDYGQTSKMSPRVPQ
QDWLSQPPARVTIKMECNPSQVNGSRNSPDECSVAKGGKMVGSPDTVGMNYGSYMEEKHM
PPPNMTTNERRVIVPADPTLWSTDHVRQWLEWAVKEYGLPDVNILLFQNIDGKELCKMTK
DDFQRLTPSYNADILLSHLHYLRETPLPHLTSDDVDKALQNSPRLMHARNTGGAAFIFPN
TSVYPEATQRITTRPDLPYEPPRRSAWTGHGHPTPQSKAAQPSPSTVPKTEDQRPQLDPY
QILGPTSSRLANPGSGQIQLWQFLLELLSDSSNSSCITWEGTNGEFKMTDPDEVARRWGE
RKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQPHPPESSLYKYPS
DLPYMGSYHAHPQKMNFVAPHPPALPVTSSSFFAAPNPYWNSPTGGIYPNTRLPTSHMPS
HLGTYY
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgattcagactgtcccggacccagcagctcatatcaaggaagccttatcagttgtgagt
gaggaccagtcattgtttgagtgtgcctacggaacgccacacctggctaagacggagatg
accgcgtcctcctccagcgactatggacagacttccaagatgagcccacgcgtccctcag
caggactggctgtctcaacccccagccagggtcaccatcaaaatggaatgtaaccctagc
caggtgaatggctcaaggaactctcctgatgaatgcagcgtggccaaaggcgggaagatg
gtgggcagcccagacactgtcgggatgaactatggcagctacatggaggagaagcacatg
ccacccccaaacatgaccacgaacgaacgcagagttatcgtgccagcagatcctacgcta
tggagtacagaccatgtgcggcagtggctggagtgggcggtgaaagaatatggccttcca
gacgtcaacatcttgttattccagaacattgatgggaaggaactgtgcaagatgaccaag
gacgacttccagaggctcacccccagctacaacgccgacattcttctctcacatctccac
tacctcagagagactcctcttccacatttgacttcagatgatgttgataaagccttacaa
aactctccacggttaatgcatgctagaaacacagggggtgcagcttttattttcccaaat
acttcagtatatcctgaagctacgcaaagaattacaactaggccagatttaccatatgag
cctcccaggagatcagcctggaccggtcacggccaccccacgccccagtcgaaagctgct
caaccatctccttccacagtgcccaaaactgaagaccagcgtcctcagttagatccttat
cagattcttggaccaacaagtagccgccttgcaaatccaggcagtggccagatccagctt
tggcagttcctcctggagctcctgtcggacagctccaactccagctgcatcacctgggaa
ggcaccaacggggagttcaagatgacggatcccgacgaggtggcccggcgctggggagag
cggaagagcaaacccaatatgaactacgataagctcagccgcgccctccgttactactat
gacaagaacatcatgaccaaggtccacgggaagcgctacgcctacaagttcgacttccac
gggatcgcccaggccctccagccccaccccccggagtcatctctgtacaagtacccctca
gacctcccgtacatgggctcctatcacgcccacccgcagaagatgaactttgtggcaccc
caccctccagccctccccgtgacatcttccagtttttttgctgccccaaacccatactgg
aattcaccaactgggggtatataccctaacactaggctccccaccagccatatgccttct
catctgggcacttactactaa

DBGET integrated database retrieval system