KEGG   Macaca fascicularis (crab-eating macaque): 102123076Help
Entry
102123076         CDS       T02918                                 

Gene name
AMY2A
Definition
(RefSeq) pancreatic alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf00500  Starch and sucrose metabolism
mcf01100  Metabolic pathways
mcf04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    102123076 (AMY2A)
 09150 Organismal Systems
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    102123076 (AMY2A)
Enzymes [BR:mcf01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     102123076 (AMY2A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase_C Alpha-amylase DUF3078
Motif
Other DBs
NCBI-GeneID: 102123076
NCBI-ProteinID: XP_005542617
UniProt: A0A2K5TSZ9
LinkDB All DBs
Position
1
AA seq 511 aa AA seqDB search
MKFFLLLLTIGFCWAQYSPNTQQGRTSIVHLFEWRWADIALECERYLAPKGFGGVQVSPP
NENVAIYNPSRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGN
AVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTSSGDIENYNDATQVRDCRLSGL
LDLALEKDYVRSEIAEYMNKLIDMGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPQG
SKPFIFQEVIDLGGEPIKSSEYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWG
FMPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWP
RNFQNGKDVNDWVGPPNNNGVTKEVTINPDTTCGNDWVCEHRWRQIRNMVAFRNVVDGEP
FTNWYDNGSNQVAFGRGNKGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKIDGNCTGI
KIYVSNDGKAQFSISNSAEDPFIAIHVESKL
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgaagttctttctgttgcttttaaccattgggttctgctgggctcagtattccccaaat
acacaacaaggacggacatctatcgttcatctgtttgaatggcgatgggctgatattgct
cttgaatgtgagcgatatttagctcccaaggggtttggaggggttcaggtctctccacca
aatgaaaatgttgcaatttacaatccttcaagaccttggtgggaaagataccaaccagtt
agctataaattatgcacaagatctggaaatgaagatgaatttagaaacatggtgactaga
tgtaacaatgttggggttcgtatttatgtggatgctgtaattaatcatatgtgtggtaat
gccgtgagtgcaggaacaagcagtacttgtggaagttacttcaaccctggaagtagggac
tttccagcagtcccgtattctggatgggattttaacgatggtaaatgtaaaacttcaagt
ggagatattgagaactataatgatgctactcaggtcagagattgtcgtctgagtggtctt
cttgatcttgcgctggagaaggattatgtgcgttccgagattgccgaatatatgaacaag
ctcattgacatgggagttgcagggttcagacttgatgcttccaagcacatgtggcctgga
gacataaaggcaattttggacaaactgcataatctcaacagtaactggtttcctcaagga
agtaaacctttcattttccaggaggtaattgacctgggtggtgagccaattaaaagcagt
gagtactttggaaatggccgggtgacagaattcaagtatggtgcaaaactcggcacagtt
attcgcaagtggaatggagagaagatgtcttacttaaagaactggggagaaggttggggt
ttcatgccttctgacagagcacttgtctttgtggataaccatgacaatcaacgaggacat
ggggctggaggagcctctattcttaccttctgggacgccaggctgtataaaatggcagtt
ggatttatgcttgctcatccttatggatttacacgagtaatgtcaagctaccgttggcca
agaaattttcaaaatggaaaagatgttaatgactgggttgggccaccaaataataatgga
gtaactaaagaagttactattaatccagacactacttgtggcaatgactgggtctgtgaa
catcgatggcgccaaataaggaacatggttgctttccgcaatgtagtggatggtgagcct
tttacaaactggtatgataatgggagcaaccaagtggcttttggaagaggaaacaaagga
ttcattgttttcaacaatgatgactggtcattttctttaactttgcaaactggtcttcct
gctggcacatactgtgatgtcatttctggagataaaattgatggcaattgcacaggcatt
aaaatctacgtttctaatgatggcaaagctcaattttctattagtaactctgctgaagat
ccatttattgcaattcatgttgaatctaaattataa

DBGET integrated database retrieval system