KEGG   Macaca fascicularis (crab-eating macaque): 102123983Help
Entry
102123983         CDS       T02918                                 

Gene name
JAK1
Definition
(RefSeq) Janus kinase 1
  KO
K11217  Janus kinase 1 [EC:2.7.10.2]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf01521  EGFR tyrosine kinase inhibitor resistance
mcf04151  PI3K-Akt signaling pathway
mcf04217  Necroptosis
mcf04380  Osteoclast differentiation
mcf04550  Signaling pathways regulating pluripotency of stem cells
mcf04621  NOD-like receptor signaling pathway
mcf04630  Jak-STAT signaling pathway
mcf04658  Th1 and Th2 cell differentiation
mcf04659  Th17 cell differentiation
mcf05140  Leishmaniasis
mcf05145  Toxoplasmosis
mcf05152  Tuberculosis
mcf05160  Hepatitis C
mcf05161  Hepatitis B
mcf05162  Measles
mcf05163  Human cytomegalovirus infection
mcf05164  Influenza A
mcf05165  Human papillomavirus infection
mcf05166  Human T-cell leukemia virus 1 infection
mcf05167  Kaposi sarcoma-associated herpesvirus infection
mcf05168  Herpes simplex virus 1 infection
mcf05169  Epstein-Barr virus infection
mcf05200  Pathways in cancer
mcf05203  Viral carcinogenesis
mcf05212  Pancreatic cancer
mcf05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    102123983 (JAK1)
   04151 PI3K-Akt signaling pathway
    102123983 (JAK1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    102123983 (JAK1)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    102123983 (JAK1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    102123983 (JAK1)
   04658 Th1 and Th2 cell differentiation
    102123983 (JAK1)
   04659 Th17 cell differentiation
    102123983 (JAK1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102123983 (JAK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102123983 (JAK1)
   05203 Viral carcinogenesis
    102123983 (JAK1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102123983 (JAK1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    102123983 (JAK1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    102123983 (JAK1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102123983 (JAK1)
   05162 Measles
    102123983 (JAK1)
   05164 Influenza A
    102123983 (JAK1)
   05161 Hepatitis B
    102123983 (JAK1)
   05160 Hepatitis C
    102123983 (JAK1)
   05168 Herpes simplex virus 1 infection
    102123983 (JAK1)
   05163 Human cytomegalovirus infection
    102123983 (JAK1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102123983 (JAK1)
   05169 Epstein-Barr virus infection
    102123983 (JAK1)
   05165 Human papillomavirus infection
    102123983 (JAK1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102123983 (JAK1)
   05140 Leishmaniasis
    102123983 (JAK1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102123983 (JAK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcf01001]
    102123983 (JAK1)
Enzymes [BR:mcf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     102123983 (JAK1)
Protein kinases [BR:mcf01001]
 Non-receptor tyrosine kinases
  JAK family [OT]
   102123983 (JAK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase FERM_F2 Jak1_Phl FERM_F1 SH2 FERM_M
Motif
Other DBs
NCBI-GeneID: 102123983
NCBI-ProteinID: XP_005543214
UniProt: A0A2K5WAH4
LinkDB All DBs
Position
1
AA seq 1154 aa AA seqDB search
MQYLNIKEDCNAMAFCAKMRSSKKTEVNLEVPEPGVEVIFYMSDREPLRLGSGEYTAEEL
CIRAAQACRISPLCHNLFALYDENTKLWYAPNRTITVDDKMSLRLHYRMRFYFTNWHGTN
DNEQSVWRHSPKKQKNGYEKKKVPDATPLLDASSLEYLFAQGQYDLVKCLAPIRDPKTEQ
DGHDIENECLGMAVLAISHYAMMKKMQLPELPKDISYKRYIPETLNKSIRQRNLLTRMRI
NNVFKDFLKEFNNKTICDSSVSTHDLKVKYLATLETLTKHYGAEIFETSMLLISSENEMN
WFHSNDSGNVLYYEVMVTGNLGIQWRHKPNVVSVEKEKNKLKRKKLENKHKKDEEKNKIR
EEWNNFSYFPEITHIVIKESVVSINKQDNKKMELKLSSHEEALSFVSLVDGYFRLTADAH
HYLCTDVAPPLIVHNIQNGCHGPICTEYAINKLRQEGSEEGMYVLRWSCTDFDNILMTVT
CFEKSEQGQGAQKQFKNFQIEVQKGRYSLHGSDRSFPSLGDLMSHLKKQILRTDNISFML
KRCCQPKPREISNLLVATKKAQEWQPVYPMSQLSFDRIFKKDLVQGEHLGRGTRTHIYSG
TLMDYKDDEGTSEEKKIKVILKVLDPSHRDISLAFFEAASMMRQVSHKHIVYLYGVCVRD
VENIMVEEFVEGGPLDLFMHRKSDVLTTPWKFKVAKQLASALSYLEDKDLVHGNVCTKNL
LLAREGIDSECGPFIKLSDPGIPITVLSRQECIERIPWIAPECVEDSKNLSVAADKWSFG
TTLWEICYNGEIPLKDKTLIEKERFYESRCRPVTPSCKELADLMTRCMNYDPNQRPFFRA
IMRDINKLEEQNPDIVSEKKPATEVDPTHFEKRFLKRIRDLGEGHFGKVELCRYDPEGDN
TGEQVAVKSLKPESGGNHIADLKKEIEILRNLYHENIVKYKGICTEDGGNGIKLIMEFLP
SGSLKEYLPKNKNKINLKQQLKYAVQICKGMDYLGSRQYVHRDLAARNVLVESEHQVKIG
DFGLTKAIETDKEYYTVKDDRDSPVFWYAPECLMQSKFYIASDVWSFGVTLHELLTYCDS
DSSPMALFLKMIGPTHGQMTVTRLVNTLKEGKRLPCPPNCPDEVYQLMRKCWEFQPSNRT
SFQNLIEGFEALLK
NT seq 3465 nt NT seq  +upstreamnt  +downstreamnt
atgcagtatctaaatataaaagaggactgcaatgccatggctttctgtgctaaaatgagg
agctccaagaagactgaggtgaacctggaggtccctgagccaggggtggaagtgatcttc
tatatgtcggacagggagcccctccggctgggcagtggagagtatacagcagaggaactg
tgcatcagggctgcacaggcatgccgtatctctcctctttgtcacaacctctttgccctg
tatgatgagaacaccaagctctggtatgctccaaatcgcaccatcaccgttgatgacaag
atgtccctccgactccactaccggatgaggttctatttcaccaattggcacggaaccaac
gacaatgagcagtcagtgtggcgtcattctccaaagaagcagaaaaatggctacgagaaa
aaaaaggttccagatgcaacccctctccttgatgccagctcactggagtatctgtttgct
cagggacagtatgatttggtgaaatgcctggctcccattcgagaccccaagaccgagcag
gatgggcatgatattgaaaacgagtgtctggggatggctgtcctggccatctcacactat
gccatgatgaagaagatgcagttgccagaactgcccaaggacatcagctacaagcgatat
attccagaaacattgaataagtccatcagacagaggaaccttctcaccaggatgcggata
aataatgttttcaaggatttcctaaaggaatttaacaacaagaccatttgtgacagcagc
gtgtccacgcatgacctgaaggtgaaatacttggctaccttggaaactttgacaaaacat
tatggcgctgaaatatttgagacttccatgttgctgatttcatcagaaaatgagatgaat
tggtttcattcgaatgacagtggaaacgttctgtactatgaagtgatggtgactgggaat
cttggaatccagtggaggcataaaccaaatgttgtttctgttgaaaaggaaaaaaataaa
ctgaagcggaaaaaactggaaaataaacacaagaaggatgaggagaaaaacaagatccgg
gaagagtggaataatttttcttacttccctgaaatcactcacattgtaataaaggagtct
gtggtcagcattaacaagcaggacaacaagaaaatggaactgaagctctcttcccatgag
gaggccttgtcctttgtgtcactggtagatggctacttccggctcaccgcagacgcccat
cattacctctgcaccgacgtggcccccccgttgatcgtccacaacatacagaatggctgt
catggtccaatctgtacagaatatgccatcaataaattgcggcaagaaggaagcgaggag
gggatgtacgtgctgaggtggagctgcaccgactttgacaacatcctcatgaccgtcacc
tgctttgagaagtctgagcaggggcagggtgcccagaagcagttcaagaactttcagatc
gaggtgcagaagggccgctacagcctgcatggttcagaccgcagcttccccagcttggga
gacctcatgagccacctcaagaagcagatcctgcgcacggataacatcagcttcatgttg
aaacgctgctgccagcccaagccccgagaaatctccaacctgctggtggctactaagaaa
gcccaggagtggcagcccgtctaccccatgagccagctgagttttgatcggattttcaag
aaggatctggtgcagggcgagcaccttgggagaggcacgagaacacacatctactctggg
accctgatggattacaaggatgacgaaggaacttctgaagagaagaagataaaagtgatc
ctcaaagtcttagaccccagccacagggatatttccctggccttcttcgaggcagccagc
atgatgagacaggtctcccacaaacacatcgtgtacctctatggcgtctgtgtccgcgac
gtggagaatatcatggtggaagagtttgtggaagggggtcctctggatctcttcatgcac
cggaaaagcgatgtccttactacaccctggaaattcaaagttgccaaacagctggccagt
gccctgagctacttggaagataaagacctggtccatggaaatgtgtgtactaaaaacctc
ctcctggcccgtgagggcatcgacagcgagtgtggtccgttcatcaagctcagtgaccct
ggcatccccattacggtgctgtctaggcaagagtgcattgaacgaatcccatggattgct
cctgagtgtgttgaggactccaagaacctgagtgtggctgctgacaagtggagctttgga
actacgctctgggaaatctgctacaatggcgagatccccttgaaagacaagacactgatt
gagaaagagagattctatgaaagccggtgcaggccagtgacaccatcatgtaaggagctg
gctgacctcatgacccgctgcatgaactacgaccccaatcagaggcccttcttccgagcc
atcatgagagacattaataagcttgaagagcagaatccagatattgtttcagaaaaaaag
ccagcaactgaagtggaccccacgcattttgagaagcgcttcctaaagaggatccgtgac
ttgggagagggccactttgggaaggttgagctctgcaggtatgaccccgaaggggacaat
acaggggagcaggtggctgtcaaatctctgaagcctgagagtggaggtaaccacatagct
gatctgaaaaaggaaatcgagatcttaaggaacctctatcatgagaacattgtgaagtac
aaaggaatctgcacggaagacggaggaaatggtattaagctcatcatggaatttctgcct
tcgggaagccttaaggagtatcttccaaagaataagaacaaaattaacctcaaacagcag
ctaaaatatgccgttcagatttgtaaggggatggactatttgggttctcggcaatatgtt
caccgtgacttggcagcaagaaatgtccttgttgagagtgaacaccaagtgaaaattgga
gacttcggtttaaccaaagcaattgaaaccgataaggagtattacaccgtcaaggatgac
cgggacagccctgtgttttggtatgctccagaatgtttaatgcaatctaaattttatatc
gcctctgacgtctggtcttttggagtcactctgcatgagctgctgacttactgtgactca
gattctagtcccatggctttgttcctgaaaatgataggcccaacccatggccagatgaca
gtcacaagacttgtgaatacattaaaagaaggaaaacgcctgccgtgcccgcctaactgt
ccagatgaggtttatcaacttatgaggaaatgctgggaattccaaccatccaatcggaca
agctttcagaaccttattgaaggatttgaagcactcttaaaataa

DBGET integrated database retrieval system