KEGG   Macaca fascicularis (crab-eating macaque): 102125039Help
Entry
102125039         CDS       T02918                                 

Gene name
HDAC1
Definition
(RefSeq) histone deacetylase 1
  KO
K06067  histone deacetylase 1/2 [EC:3.5.1.98]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04110  Cell cycle
mcf04213  Longevity regulating pathway - multiple species
mcf04330  Notch signaling pathway
mcf04919  Thyroid hormone signaling pathway
mcf05016  Huntington's disease
mcf05034  Alcoholism
mcf05165  Human papillomavirus infection
mcf05169  Epstein-Barr virus infection
mcf05200  Pathways in cancer
mcf05202  Transcriptional misregulation in cancer
mcf05203  Viral carcinogenesis
mcf05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:mcf00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    102125039 (HDAC1)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    102125039 (HDAC1)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    102125039 (HDAC1)
  Aging
   04213 Longevity regulating pathway - multiple species
    102125039 (HDAC1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    102125039 (HDAC1)
   05202 Transcriptional misregulation in cancers
    102125039 (HDAC1)
   05203 Viral carcinogenesis
    102125039 (HDAC1)
   05220 Chronic myeloid leukemia
    102125039 (HDAC1)
  Neurodegenerative diseases
   05016 Huntington's disease
    102125039 (HDAC1)
  Substance dependence
   05034 Alcoholism
    102125039 (HDAC1)
  Infectious diseases
   05169 Epstein-Barr virus infection
    102125039 (HDAC1)
   05165 Human papillomavirus infection
    102125039 (HDAC1)
Enzymes [BR:mcf01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     102125039 (HDAC1)
Chromosome and associated proteins [BR:mcf03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     102125039 (HDAC1)
   HDAC complexes
    Sin3A-HDAC complex
     102125039 (HDAC1)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    102125039 (HDAC1)
  Chromatin remodeling factors
   NuRD complex
    102125039 (HDAC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 102125039
NCBI-ProteinID: XP_005544162
UniProt: A0A2K5U8T1
LinkDB All DBs
Position
1
AA seq 482 aa AA seqDB search
MAQTQGTRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKAN
AEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAS
AVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHG
DGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAI
FKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGG
GGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLE
KIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEEDPDKRISICSSDKRIACEEEF
SDSEEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKPEAKGVKEEVK
LA
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagacgcagggcacccggaggaaagtctgttactactacgacggggatgttgga
aattactactacggacaaggccacccaatgaagcctcaccgaatccgcatgactcataat
ttgctgctcaactatggtctctaccgaaaaatggaaatctatcgccctcacaaagccaat
gctgaggagatgaccaagtaccatagtgacgactacattaaattcttgcgctccatccgt
ccagataacatgtcggagtacagcaagcagatgcagagattcaacgttggtgaggactgt
ccagtattcgacggcctgtttgagttctgtcagttgtctactggtggttctgtggcaagt
gctgtgaaacttaataagcagcagacggacatcgctgtgaattgggctgggggcctgcac
catgcaaagaagtctgaggcatctggcttctgttacgtcaatgatatcgtcttggccatc
ctggaactgctaaagtatcaccagagggtgctgtatattgacattgatattcaccatggc
gacggcgtggaagaggccttctataccacagaccgggtcatgactgtgtcctttcataag
tatggagagtacttcccaggaactggggacctgcgggatatcggggctggaaaaggcaag
tattatgctgttaactacccgctccgagacgggattgatgacgagtcctatgaggccatt
ttcaagccggtcatgtccaaagtaatggagatgttccaacctagcgcggtggtcttacag
tgtggctcagactccctgtctggggatcggttaggttgcttcaatctaaccatcaaaggg
cacgccaagtgtgtggaatttgtcaagagctttaacctgcctatgctgatgctgggaggt
ggtggttacaccattcgtaatgttgcccggtgctggacatacgagacagctgtggccctg
gatacggagatccctaatgagcttccatacaacgactactttgaatactttggaccggat
ttcaagctccacatcagtccttccaatatgactaaccagaacacgaatgagtacctggag
aagatcaaacagcggctgtttgagaaccttagaatgctgccacatgcacctggggtccaa
atgcaggcgattcctgaggacgccatccctgaggagagtggcgatgaggacgaagaagac
cctgacaagcgcatctcgatctgctcctccgacaaacgaattgcctgtgaggaagagttc
tccgattctgaagaggagggagaggggggccgcaagaactcttccaacttcaaaaaagcc
aagagagtcaaaacagaggatgaaaaagagaaagacccagaggagaagaaagaagtcaca
gaagaggagaaaaccaaggaggaaaagccagaagccaaaggggtcaaggaggaggtcaag
ttagcctga

DBGET integrated database retrieval system