KEGG   Macaca fascicularis (crab-eating macaque): 102125557Help
Entry
102125557         CDS       T02918                                 

Gene name
PFKP
Definition
(RefSeq) phosphofructokinase, platelet
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf00010  Glycolysis / Gluconeogenesis
mcf00030  Pentose phosphate pathway
mcf00051  Fructose and mannose metabolism
mcf00052  Galactose metabolism
mcf01100  Metabolic pathways
mcf01200  Carbon metabolism
mcf01230  Biosynthesis of amino acids
mcf03018  RNA degradation
mcf04152  AMPK signaling pathway
mcf05230  Central carbon metabolism in cancer
Module
mcf_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    102125557 (PFKP)
   00030 Pentose phosphate pathway
    102125557 (PFKP)
   00051 Fructose and mannose metabolism
    102125557 (PFKP)
   00052 Galactose metabolism
    102125557 (PFKP)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    102125557 (PFKP)
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    102125557 (PFKP)
 09160 Human Diseases
  09161 Cancers: Overview
   05230 Central carbon metabolism in cancer
    102125557 (PFKP)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mcf01009]
    102125557 (PFKP)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mcf03019]
    102125557 (PFKP)
Enzymes [BR:mcf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     102125557 (PFKP)
Protein phosphatases and associated proteins [BR:mcf01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     102125557 (PFKP)
Messenger RNA biogenesis [BR:mcf03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     102125557 (PFKP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 102125557
NCBI-ProteinID: XP_005564579
LinkDB All DBs
Position
9
AA seq 783 aa AA seqDB search
MDADDSRAPKGSLRKFLEHLSGAGKAIGVLTSGGDAQGARPPPSVVPIYGVHVIFKIFFI
EGYQGMVDGGANIAEADWESVSSILQVGGTIIGSARCQAFRTREGRLKAACNLLQRGITN
LCVIGGDGSLTGANLFRKEWSGLLEELARNGQIDKEAVQKYAYLNVVGMVGSIDNDFCGT
DMTIGTDSALHRIIEVIDAIMTTAQSHQRTFVLEVMGRHCGYLALVSALACGADWVFLPE
SPPEQGWEEQMCVKLSENRARKKRLNIIIVAEGAIDTQNKPITSEKIKELVVTQLGYDTR
VTILGHVQRGGTPSAFDRILASRMGVEAVIALLEATPDTPACVVSLNGNHAVRLPLMECV
QMTQDVQKAMDERRFQDAVRLRGRSFAGNLNTYKRLAIKLPDDQIPKTNCNVAVINVGAP
AAGMNAAVRSAVRVGIADGHRMLAIYDGFDGFAKGQIKEIGWTDVGGWTGQGGSILGTKR
ILPGKYLEEIATQMRTHSINALLIIGGFEAYLGLLELSAAREKHEEFCVPMVMVPATVSN
NVPGSDFSIGADTALNTITDTCDRIKQSASGTKRRVFIIETMGGYCGYLANMGGLAAGAD
AAYIFEEPFDIRDLQSNVEHLTEKMKTTIQRGLVLRNESCSENYTTDFIYQLYSEEGKGV
FDCRKNVLGHMQQGGAPSPFDRNFGTKISARAMEWITAKLKEARGRGKKFTTDDSVCVLG
ISKRNVIFQPVAELKQQTDFEHRIPKEQWWLKLRPLMKILAKYKASYDVSDSGQLEHVQP
WSV
NT seq 2352 nt NT seq  +upstreamnt  +downstreamnt
atggacgcggacgactcccgggcccccaagggctccttgcggaagttcctggagcacctc
tccggggccggcaaggccatcggcgtgctgaccagcggcggggatgctcaaggtgcgcgc
ccccctcccagcgttgtacctatttatggggtacatgtgattttcaaaattttttttatt
gaaggctaccagggcatggtggacggaggcgcgaacatcgcggaggccgactgggagagc
gtctccagcatcctgcaagtgggcgggacgatcattggcagtgcgcggtgccaggccttc
cgcacgcgggaaggccgcctgaaggccgcctgcaacctgctgcagcgcggcatcaccaac
ctgtgtgtgatcggcggggacgggagcctcaccggggccaacctcttccggaaggagtgg
agcgggctgctggaggagctggccaggaatggccagatcgataaggaggccgtgcagaag
tacgcctacctcaacgtggtgggcatggtgggctccattgacaatgatttctgtggcacc
gacatgaccatcggcactgactccgccctgcataggatcatcgaggtcattgacgccatc
atgaccacggcccagagccaccagaggaccttcgttctggaggtgatgggacgacactgt
gggtacctggccctggtgagtgccttggcctgcggtgcagactgggtgttccttccggag
tctccgccagagcaaggctgggaggagcagatgtgtgtcaaactctcggagaaccgtgcc
cggaaaaaaagactgaatattattattgtggctgaaggagcaattgatacccaaaataaa
cccattacctctgagaaaatcaaagagctcgtcgtcacgcagctgggctatgacacacgt
gtgaccatcctcgggcacgtgcagagaggagggaccccctcggcattcgacaggatcttg
gccagccgcatgggggtggaggcagtcatcgccttgctagaggctaccccggacacccca
gcttgcgtcgtgtcgctgaacgggaaccacgccgtgcgcctgccactgatggagtgcgtg
cagatgactcaggatgtgcagaaggcgatggacgagaggagatttcaagatgcggttcgg
ctccgagggaggagctttgcgggcaacctgaacacctacaagcgactcgccatcaagctg
ccggatgatcagatcccaaagaccaattgcaacgtagctgtcatcaatgtgggggcgccc
gcggccgggatgaacgcggccgtgcgctcagctgtgcgcgtgggcattgccgacggccac
aggatgctcgccatctacgatggctttgatggcttcgccaagggccagatcaaagaaatc
ggctggacagatgtcgggggctggaccggccaaggaggctccattcttgggacaaaacgc
attctcccgggaaagtacctggaggagatcgccacgcagatgcgcacgcacagcatcaac
gcgctactgatcatcggcgggtttgaggcctacctgggactcctggagctgtcagccgcc
cgggagaagcacgaggagttctgtgtgcccatggtcatggttcccgctactgtgtccaac
aatgtgccgggttccgatttcagcattggggcagacacagccctgaacactatcaccgac
acctgcgaccgcatcaagcagtccgccagcggaaccaagcggcgcgtgttcatcatcgag
accatgggcggctactgtggctacctggccaacatgggggggctcgcggccggagccgat
gccgcatacattttcgaagagcccttcgacatcagggatctgcagtccaatgtggagcac
ctgacggagaaaatgaagaccaccatccagaggggccttgtgctcagaaatgagagctgc
agtgaaaactacaccaccgacttcatttaccagctctattcggaagagggcaaaggcgtg
tttgactgcaggaagaacgtgctgggccacatgcagcagggtggggcaccctctccattt
gatagaaactttggaaccaaaatctctgccagagctatggagtggatcactgcgaaactc
aaggaggcccggggcagaggaaaaaaatttaccaccgatgattccgtttgcgtgctggga
ataagcaaaagaaacgttatttttcaacctgtggcagagctgaagcagcaaacggatttt
gagcacaggattcccaaagaacagtggtggctcaagctgcggcccctcatgaagatcctg
gccaagtacaaggccagctacgacgtgtcggactcaggccagctagagcacgtgcagccc
tggagcgtctga

DBGET integrated database retrieval system