KEGG   Macaca fascicularis (crab-eating macaque): 102126003Help
Entry
102126003         CDS       T02918                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial-like
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf00020  Citrate cycle (TCA cycle)
mcf00190  Oxidative phosphorylation
mcf01100  Metabolic pathways
mcf01200  Carbon metabolism
mcf04714  Thermogenesis
mcf04932  Non-alcoholic fatty liver disease (NAFLD)
mcf05010  Alzheimer disease
mcf05012  Parkinson disease
mcf05016  Huntington disease
Module
mcf_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mcf_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
mcf_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    102126003
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    102126003
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    102126003
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102126003
   05012 Parkinson disease
    102126003
   05016 Huntington disease
    102126003
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    102126003
Enzymes [BR:mcf01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     102126003
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Pyr_redox_2 FAD_binding_3 GIDA DAO Thi4 Lycopene_cycl HI0933_like
Motif
Other DBs
NCBI-GeneID: 102126003
NCBI-ProteinID: NP_001306406
UniProt: I7GH33
LinkDB All DBs
Position
6
AA seq 253 aa AA seqDB search
MSGVRRLSRLLSTRRLALAKAWPAVLQTGTRGFHFTVDGNKRASAKVSDSISAQYPVVDH
EFDAVVVGAGGAGLRAAFGLSEAGFNTACVTKLFPTRSHTVAAQGGINAALGNMEEDNWR
WHFYDTVKGSDWLGDQDAIHYMTEQAPAAVVELENYGMPFSRTEDGKIYQRAFGGQSLKF
GKGGQAHRCCCVADRTGHSLLHTLYGRSLRYDTSYFVEYFALDLLMEDGECRGVIALCII
TWAAFPPTTRGRS
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggggtccggagactgtcgcggctgctgagcactcggcgcctggcgctggccaag
gcgtggccagcagtgttgcaaacaggaacccgaggttttcacttcactgttgatgggaac
aagagggcatctgctaaagtttcagattccatttctgctcagtatccagtagtggatcat
gaatttgatgcggtggtggtaggcgctggaggggcaggcttgcgagctgcatttggcctt
tctgaggcagggtttaatacagcatgtgttacaaagctgtttcctaccaggtcacacact
gttgcggcacagggaggaatcaacgctgctctggggaacatggaggaggacaactggagg
tggcatttctacgacactgtgaagggctccgactggctgggggaccaggatgccatccac
tacatgacagagcaggctcccgccgccgtggtcgagctggaaaattacggcatgccgttt
agcagaactgaagatgggaagatttatcagcgtgcatttggtggacagagcctcaagttt
ggaaagggcgggcaggcccatcggtgctgctgtgtggctgatcggaccggccactcacta
ttgcacaccttatatggaaggtccctgcgatacgataccagctattttgtggagtatttt
gccttggatctcctgatggaggacggggagtgccgtggtgtcatcgcactgtgcattata
acatgggcggcattcccaccaactacaaggggcaggtcctga

DBGET integrated database retrieval system