KEGG   Macaca fascicularis (crab-eating macaque): 102126944Help
Entry
102126944         CDS       T02918                                 

Gene name
GNG12
Definition
(RefSeq) G protein subunit gamma 12
  KO
K04347  guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-12
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04010  MAPK signaling pathway
mcf04014  Ras signaling pathway
mcf04062  Chemokine signaling pathway
mcf04151  PI3K-Akt signaling pathway
mcf04371  Apelin signaling pathway
mcf04713  Circadian entrainment
mcf04723  Retrograde endocannabinoid signaling
mcf04724  Glutamatergic synapse
mcf04725  Cholinergic synapse
mcf04726  Serotonergic synapse
mcf04727  GABAergic synapse
mcf04728  Dopaminergic synapse
mcf04810  Regulation of actin cytoskeleton
mcf04926  Relaxin signaling pathway
mcf05032  Morphine addiction
mcf05034  Alcoholism
mcf05163  Human cytomegalovirus infection
mcf05167  Kaposi sarcoma-associated herpesvirus infection
mcf05170  Human immunodeficiency virus 1 infection
mcf05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    102126944 (GNG12)
   04010 MAPK signaling pathway
    102126944 (GNG12)
   04371 Apelin signaling pathway
    102126944 (GNG12)
   04151 PI3K-Akt signaling pathway
    102126944 (GNG12)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102126944 (GNG12)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    102126944 (GNG12)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    102126944 (GNG12)
  09156 Nervous system
   04724 Glutamatergic synapse
    102126944 (GNG12)
   04727 GABAergic synapse
    102126944 (GNG12)
   04725 Cholinergic synapse
    102126944 (GNG12)
   04728 Dopaminergic synapse
    102126944 (GNG12)
   04726 Serotonergic synapse
    102126944 (GNG12)
   04723 Retrograde endocannabinoid signaling
    102126944 (GNG12)
  09159 Environmental adaptation
   04713 Circadian entrainment
    102126944 (GNG12)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    102126944 (GNG12)
  09165 Substance dependence
   05032 Morphine addiction
    102126944 (GNG12)
   05034 Alcoholism
    102126944 (GNG12)
  09172 Infectious diseases: Viral
   05170 Human immunodeficiency virus 1 infection
    102126944 (GNG12)
   05163 Human cytomegalovirus infection
    102126944 (GNG12)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102126944 (GNG12)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcf04147]
    102126944 (GNG12)
   04031 GTP-binding proteins [BR:mcf04031]
    102126944 (GNG12)
Exosome [BR:mcf04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102126944 (GNG12)
  Exosomal proteins of colorectal cancer cells
   102126944 (GNG12)
GTP-binding proteins [BR:mcf04031]
 Heterotrimeric G-proteins
  Gamma Subunits
   Gamma [OT]
    102126944 (GNG12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G-gamma CP12
Motif
Other DBs
NCBI-GeneID: 102126944
NCBI-ProteinID: XP_005543126
UniProt: G7NWY8
LinkDB All DBs
Position
1
AA seq 72 aa AA seqDB search
MSSKTASTNNIAQARRTVQQLRLEASIERIKVSKASADLMSYCEEHARSDPLLIGIPTSE
NPFKDKKTCIIL
NT seq 219 nt NT seq  +upstreamnt  +downstreamnt
atgtccagcaaaacagcaagtaccaacaatatagcccaggcaaggagaactgtgcaacag
ttaagattagaagcctccattgaaagaataaaggtttcgaaggcatcagcggacctcatg
tcctactgtgaggaacatgccaggagtgaccctttgctgataggaataccaacttcagaa
aaccctttcaaggataaaaaaacttgcatcatcttatag

DBGET integrated database retrieval system