KEGG   Macaca fascicularis (crab-eating macaque): 102127260Help
Entry
102127260         CDS       T02918                                 

Gene name
GPD2, GPD-M, GPDH-M, mtGPD
Definition
(RefSeq) glycerol-3-phosphate dehydrogenase 2
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    102127260 (GPD2)
Enzymes [BR:mcf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     102127260 (GPD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAO DAO_C EF-hand_7 EF-hand_1 EF-hand_6 FAD_binding_2 GIDA FAD_oxidored EF-hand_8 EF-hand_5 Pyr_redox_2 EF-hand_9 EF-hand_10 NAD_binding_8 HI0933_like FAD_binding_3 Thi4 Pyr_redox_3 SPARC_Ca_bdg EF-hand_4
Motif
Other DBs
NCBI-GeneID: 102127260
NCBI-ProteinID: NP_001306361
UniProt: Q4R755
LinkDB All DBs
Position
12
AA seq 727 aa AA seqDB search
MAFQKAVKGTILVGGGALATVLGLSQFAHYRRKQMNLAYVKAADYISEPVNREPPSREAQ
LLTLQNTSEFDILVIGGGATGSGCALDAVTRGLKTALVERDDFSSGTSSRSTKLIHGGVR
YLQKAIMKLDIEQYRMVKEALHERANLLEIAPHLSAPLPIVLPVYKWWQLPYYWVGIKLY
DLVAGSNCLKSSYVLSKSRALEHFPMLQKDKLVGAIVYYDGQHNDARMNLAIALTAARYG
AATANYMEVVSLLKKTDPQTGKVRVSGARCKDVLTGQEFDVRAKCVINATGPFTDSVRKM
DDKDAAAICQPSAGVHIVMPGYYSPESMGLLDPATSDGRVIFFLPWQKMTIAGTTDTPTD
VTPHPIPSEEDINFILNEVRNYLSCDVEVRRGDVLAAWSGIRPLVTDPKSADTQSISRNH
VVDISESGLITIAGGKWTTYRSMAEDTINAAIKTHNLKAGPSRTVGLFLQGGKDWSPTLY
IRLVQDYGLESEVAQHLAATYGDKAFEVAKMASVTGKRWPIVGVRLVSEFPYIEAEVKYG
IKEYACTAVDMISRRTRLAFLNVQAAEEALPRIVELMGRELNWDDHKKQEQLETAKKFLY
YEMGYKSRSEQLTDRSEISLLPSDIDRYKKRFHKFDADKKGFITIVDVQRVLESINVQMD
ENTLHEILNEVDLNKNGQVELNEFLQLMSAIQKGRVSGSRLAILMKTAEENLDRRVPIPV
DRSCGGL
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atggcatttcaaaaggcagtgaaagggactattcttgttggaggaggtgctcttgcgact
gttttaggactttctcagtttgctcattacagaaggaaacaaatgaacctggcctatgtt
aaagcagcagactacatttcagaaccagttaacagggagcctccttccagagaagctcag
ctactaactttgcaaaatacatctgaatttgatatccttgttattggaggaggagcaaca
ggaagtggctgtgcgctagatgctgtcaccagaggactaaaaacagcgcttgtagaaaga
gatgatttctcatcagggaccagcagcagaagcactaaattgatccatggtggtgtgaga
tatcttcagaaggccatcatgaagttggatattgagcagtataggatggtaaaagaagcc
cttcatgagcgtgccaacctgctagaaattgctccccatttatcagctccattgcctata
gtgcttccagtttacaagtggtggcagttaccttactactgggtaggaatcaagctgtat
gatttggttgcaggaagcaattgcctgaaaagcagttatgtcctcagcaaatcgagagcc
cttgaacatttcccaatgctccagaaggacaaactggtaggagcaattgtctactatgac
ggacaacataacgatgcacggatgaaccttgccattgctctgactgctgccaggtatggg
gctgccacagccaattacatggaggtagtgagcttgctcaagaagacagacccccagaca
gggaaagtgcgtgtgagcggcgcacggtgcaaggatgtcctcacagggcaggaatttgac
gtgagagccaaatgtgttatcaatgccacgggacctttcacggattctgtgcgcaaaatg
gatgataaagacgcagcagctatctgccagccaagtgctggtgtccatattgtgatgcct
ggttattacagcccagagagcatgggacttcttgacccagcgaccagcgatgggcgagtt
attttcttcttaccctggcaaaagatgacgatcgctggcactactgatactccaactgat
gttacaccccatccaattccttcagaggaagatatcaacttcattttgaatgaagtgcgt
aattacctgagttgtgatgttgaagtgagaagaggggatgtcctggcagcatggagtggt
atccgtcctcttgttacagaccccaaatctgcagatacccagtctatctcccgaaatcat
gttgttgatatcagtgagagtggccttattactatagcaggtggaaagtggacaacttat
cggtctatggcagaagataccataaatgctgctatcaaaactcataatttaaaagcagga
ccaagtagaacagttgggcttttccttcaagggggtaaagattggagccccacactctac
attaggcttgtccaggattatggacttgaaagtgaggtggcacagcatcttgccgccacc
tatggtgataaggcctttgaggtggccaaaatggcaagtgtgactggcaaaaggtggcct
attgttggagtacgtcttgtgtcagaatttccatatattgaagcagaggtgaaatatggg
attaaagagtatgcctgcactgctgtggatatgatttcacgtcgtactcgcctggccttt
ctaaatgtccaggcagcagaggaagccctacccaggattgttgaactgatgggcagggaa
ctgaattgggatgatcataagaagcaggaacaacttgaaacagccaagaagtttctatat
tatgaaatgggctataaatctcgatcagaacagttaacggatcgctctgaaattagccta
ctgccttcagacattgacaggtataagaagagatttcataagtttgatgcagacaagaaa
ggctttattaccattgttgatgttcagcgtgtattagagagtatcaatgtccaaatggat
gaaaatacactccatgaaattctaaatgaagtcgatttgaataaaaatggacaggttgaa
ctcaatgaatttttgcagctgatgagtgctattcaaaaaggaagggtatctggaagccgg
cttgctatactaatgaaaactgcagaagagaacctcgacagaagagttccaattccagtg
gaccgtagttgtggaggattgtga

DBGET integrated database retrieval system