KEGG   Macaca fascicularis (crab-eating macaque): 102129054Help
Entry
102129054         CDS       T02918                                 

Gene name
KMT5C, SUV420H2
Definition
(RefSeq) lysine methyltransferase 5C
  KO
K11429  histone-lysine N-methyltransferase SUV420H [EC:2.1.1.43]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    102129054 (KMT5C)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mcf03036]
    102129054 (KMT5C)
Enzymes [BR:mcf01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     102129054 (KMT5C)
Chromosome and associated proteins [BR:mcf03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     102129054 (KMT5C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET
Motif
Other DBs
NCBI-GeneID: 102129054
NCBI-ProteinID: XP_005590455
UniProt: A0A2K5U5P8
LinkDB All DBs
Position
19
AA seq 461 aa AA seqDB search
MGPDRVTARELCENDDLATSLVLDPYLGFRTHKMNVSPVPPLRRQQHLRSALETFLRQRD
LEAAYRALTLGGWTAHYFQSRGPRQEAALKTHVYRYLRAFLPESGFTILPCTRYSMETNG
AKIVSTRAWKKNEKLELLVGCIAELREADEGLLRAGENDFSIMYSTRKRSAQLWLGPAAF
INHDCKPNCKFVPADGNAACVKVLRDIEPGDEVTCFYGDGFFGEKNEHCECYTCERKGEG
AFRTRPREPALPPRPLDKYQLRETKRRLQGLDSGGRQGLLGPRVCLHPSPLRRDPFCAAC
QPLRLPACSARPDTSPLWLQWLPQPQPRVRSRKRRRPRPRRAPVLSTHHAARISLHRWGG
CGPHCRLRGEALVALGQPPRARWVPQQDWHWARRYGLPCVVRVDLRRLAPAPPPTPAPAG
TPGPILVPKQALAFAPFSPPKRLRLVVSHGSIDLDVDGEEL
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atggggccggacagagtgacagcacgagaactgtgcgagaacgacgacctggccaccagc
ctcgtcctggacccctacctcggtttccgcacccataagatgaacgtcagccctgtgccc
ccactgcggcgacagcagcacctgcgctcagcgctggaaactttcctgaggcagcgggac
ctggaggctgcgtaccgggccctgacgctgggaggctggacggcccactacttccagagc
cggggcccgcggcaggaggctgccctcaagacccacgtctatcgctacctccgtgccttc
ctgccggaaagtggctttaccatcctgccctgcacgcgctactccatggagaccaacggg
gccaagatcgtgtccactcgtgcttggaaaaagaatgagaagctggagctgctggtgggc
tgcatcgcagagctgcgggaggcggatgaggggctgctgagggctggtgagaatgacttc
agcatcatgtactcaacccgcaagcgaagtgctcagctgtggctgggcccagccgccttc
atcaaccatgactgcaaacccaactgcaagtttgtgcctgcagatgggaacgccgcctgt
gtgaaggtgctccgggacatcgagcctggggacgaggtgacgtgcttctacggcgatggc
ttcttcggcgagaaaaatgagcactgtgaatgctacacctgtgagaggaaaggcgaagga
gctttccgaacgagacctagggagcctgcgttgccaccacggcccctggacaagtaccag
ctacgtgagaccaagcggcggctgcaaggcctggacagcggcggccgacagggcctgctg
ggcccccgggtctgcctgcacccgtccccactgcgccgggacccgttctgtgccgcctgc
caacccctgcgcctgccagcctgtagcgcccgcccagacacctcacccctctggctccag
tggctgcctcagccccagccccgagtgcggtcccggaagcgccgacgcccccggccccgg
agggccccagtgctctccacccaccacgccgcccgcatctccctgcaccgatggggaggc
tgtggcccccactgccgcctgcgaggagaggccctggtggccctgggccagcccccccgt
gcccgctgggttccccagcaggactggcactgggcccggcgctatgggctgccttgcgtg
gtgcgtgtggaccttcgtcgcctggccccagccccaccacccaccccagcccctgctggg
accccaggccccatcctggtcccgaagcaggccctcgccttcgcccccttctccccaccc
aagcgcctacggctggtggtcagccacggttccatcgacctagatgtcgacggggaagag
ctgtga

DBGET integrated database retrieval system