KEGG   Macaca fascicularis (crab-eating macaque): 102129446
Entry
102129446         CDS       T02918                                 

Gene name
ATF6B
Definition
(RefSeq) activating transcription factor 6 beta
  KO
K09049  cyclic AMP-dependent transcription factor ATF-6 beta
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04022  cGMP-PKG signaling pathway
mcf04141  Protein processing in endoplasmic reticulum
mcf04151  PI3K-Akt signaling pathway
mcf04211  Longevity regulating pathway
mcf04261  Adrenergic signaling in cardiomyocytes
mcf04668  TNF signaling pathway
mcf04728  Dopaminergic synapse
mcf04911  Insulin secretion
mcf04915  Estrogen signaling pathway
mcf04918  Thyroid hormone synthesis
mcf04925  Aldosterone synthesis and secretion
mcf04926  Relaxin signaling pathway
mcf04927  Cortisol synthesis and secretion
mcf04928  Parathyroid hormone synthesis, secretion and action
mcf04934  Cushing syndrome
mcf04935  Growth hormone synthesis, secretion and action
mcf05020  Prion disease
mcf05030  Cocaine addiction
mcf05031  Amphetamine addiction
mcf05034  Alcoholism
mcf05161  Hepatitis B
mcf05163  Human cytomegalovirus infection
mcf05166  Human T-cell leukemia virus 1 infection
mcf05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    102129446 (ATF6B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    102129446 (ATF6B)
   04022 cGMP-PKG signaling pathway
    102129446 (ATF6B)
   04151 PI3K-Akt signaling pathway
    102129446 (ATF6B)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    102129446 (ATF6B)
   04915 Estrogen signaling pathway
    102129446 (ATF6B)
   04926 Relaxin signaling pathway
    102129446 (ATF6B)
   04935 Growth hormone synthesis, secretion and action
    102129446 (ATF6B)
   04918 Thyroid hormone synthesis
    102129446 (ATF6B)
   04928 Parathyroid hormone synthesis, secretion and action
    102129446 (ATF6B)
   04925 Aldosterone synthesis and secretion
    102129446 (ATF6B)
   04927 Cortisol synthesis and secretion
    102129446 (ATF6B)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102129446 (ATF6B)
  09156 Nervous system
   04728 Dopaminergic synapse
    102129446 (ATF6B)
  09149 Aging
   04211 Longevity regulating pathway
    102129446 (ATF6B)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    102129446 (ATF6B)
  09164 Neurodegenerative disease
   05020 Prion disease
    102129446 (ATF6B)
  09165 Substance dependence
   05030 Cocaine addiction
    102129446 (ATF6B)
   05031 Amphetamine addiction
    102129446 (ATF6B)
   05034 Alcoholism
    102129446 (ATF6B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102129446 (ATF6B)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102129446 (ATF6B)
   05161 Hepatitis B
    102129446 (ATF6B)
   05163 Human cytomegalovirus infection
    102129446 (ATF6B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mcf03000]
    102129446 (ATF6B)
Transcription factors [BR:mcf03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    102129446 (ATF6B)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf DUF4407 ZapB GIT_CC YabA Docking
Other DBs
NCBI-GeneID: 102129446
NCBI-ProteinID: XP_005553484
LinkDB
Position
4
AA seq 711 aa
MVGGWGGKMAELMLLSEIADPTRFFADNLLSPEDWGLQNSTLYSGLDEVAEEQTQLFRCP
EQDVPFDGSSLDVGMDVSPPEPPWELLPILPDLQVKSEPSSPCSSSSRSSESSHLSTEPS
SEALGVGEVLHVKTESLAPPLCLLGDDPTSSFETVQINVVPTSDDCSDVQTKIEPVSPCS
SINSEASLLSADSSSQAFIGEEVLEVKTESLSPSGCLLWDVPAPSLGAVQISMGPSPDGS
SGKALPIRKPPLQPKPVVLTTVPMPPRAVPPSTTVLLQPLVQPPPVSPVVLIQGAIRVQP
EGPAASLPRPERKSIVPAPMPGNSCPPEVDAKLLKRQQRMIKNRESACQSRRKKKEYLQG
LEARLQAVLADNQQLRRENAALRRRLEALLAENSELKLGSGNRKVVCIMVFLLFIAFNFG
PVSISEPPSAPVSPRMNKGEPRPRRHLLGFSEQEPVHGVEPLQGSSQGPEEPQPSPTDQP
SFRNLTTFPGGAKELLLRDLDQLFLSSDCRHFNRTESLRLADELSGWVQRHQRGRRKIPQ
RAQERQKSQPRKKSPPVKAVPIQPPGPPERDSVGQLQLYRHPDRSQPAFLDAIDRREDTF
YVVSFRRDHLLLPAISHNKTSRPKMSLVMPAMAPNETLSGRGAPGDYEEMMQIECEVMDT
RVIHIKTSTVPPSLRKQPSPTPGNATGGPLPASAASQAHQASHRPLYLNHP
NT seq 2136 nt   +upstreamnt  +downstreamnt
atggttggggggtgggggggaaagatggcggagctgatgctcctcagcgagattgccgac
ccgacgcgtttcttcgccgacaacctgctgagcccggaggactggggtctgcagaacagc
accttgtattctggcctagatgaagtggccgaggagcagacgcagctcttccgttgcccc
gagcaggatgtcccgtttgacggcagctccctggacgtggggatggatgtcagcccccct
gagcccccatgggaactcctgccgatcttgccagatcttcaggtgaagtctgagccgtct
tccccctgctcttcctcctcccgcagctccgagtcatcacatctctccacagagccctcc
agcgaggctcttggggtaggggaggtgctccatgtgaagacagagtccttggcaccccca
ctgtgtctcctgggagatgacccaacatcctcatttgaaactgtccagatcaacgtagtc
cccacttctgatgattgctcagatgtccagaccaagatagaacctgtctctccatgttct
tccatcaactctgaggcctccctgctctcagccgactcctccagccaggcttttatagga
gaggaggtcctggaagtgaagacagagtccctatccccttcagggtgcctcctatgggat
gtcccagccccctcacttggagctgtccagatcagcatgggcccatcccctgatggctcc
tcagggaaagccctgcccatccggaagccaccactgcagcccaaacctgtggtgctaacc
actgtcccaatgccacccagagctgtgcctcccagcaccaccgtccttctgcagcccctt
gtccagccacccccagtatccccagttgtcctcatccagggtgctattcgagtccagcct
gaagggccggctgcctctctaccacggcctgagaggaagagcatcgttcctgctcctatg
cctggaaactcctgcccgcctgaagtggatgcaaagctgctgaagcggcagcagcgaatg
atcaagaaccgggagtcagcctgccagtcccggagaaagaaaaaagagtatctgcagggg
ctggaggctcggctgcaggcagtgctggctgacaaccagcagctccgccgggagaatgct
gccctccggcggcggctggaggccctgctggctgaaaacagcgagctcaagttagggtct
ggaaacaggaaggtggtctgcatcatggtcttccttctcttcattgccttcaactttgga
cccgtcagcatcagtgagcctccttcagctcctgtctctcctcggatgaacaagggggag
cctcgaccccggagacacttgctggggttctcagagcaagagccagttcatggagttgaa
cctctccaggggtcctcccagggccctgaagagccccagcccagccccacagaccagccc
agtttcaggaacctgacaaccttccctgggggcgccaaggagctactactaagagaccta
gaccagctcttcctctcctctgattgcaggcacttcaaccgcaccgaatccctgaggctt
gctgacgagctgagtggctgggtccagcgccaccagagaggccggcggaagatccctcag
agggcccaggagagacagaagtctcagccacggaagaagtcacctccagttaaggcagtc
cccatccaaccccctggacccccggaaagggattctgtgggccagctgcagctatatcgc
cacccagaccgttcgcagccagcgttcttggatgcaattgaccgacgggaagacacgttt
tatgttgtctctttccgaagagaccacctgctgctcccagccatcagccacaacaagacc
tcccggcccaagatgtccctggtgatgccggccatggcccccaatgagaccctgtcaggc
cgtggggccccgggggactatgaggagatgatgcagatcgagtgtgaggtcatggacacc
agggtgattcacatcaagacctccacggtgcccccctcgctccgaaaacagccatcccca
accccaggcaatgccacaggtggccccttgccagcctctgcagccagccaggcccatcag
gcctcccaccggcccctctacctcaatcatccctga

DBGET integrated database retrieval system