KEGG   Macaca fascicularis (crab-eating macaque): 102129616Help
Entry
102129616         CDS       T02918                                 

Gene name
TGM5
Definition
(RefSeq) transglutaminase 5
  KO
K05622  transglutaminase 5 [EC:2.3.2.13]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    102129616 (TGM5)
Enzymes [BR:mcf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     102129616 (TGM5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_C Transglut_N Transglut_core
Motif
Other DBs
NCBI-GeneID: 102129616
NCBI-ProteinID: XP_005559387
UniProt: A0A2K5WWS9
LinkDB All DBs
Position
7
AA seq 720 aa AA seqDB search
MAQGLEVALTDLQSSRNNVRHHTEEITVDHLLVRRGQAFNLTLYFRNRGFQPGLDNIIFV
VETGPLPDLALGTRAVFSLARHHSPSPWIAWLETNGATSTEVSLCAPPTAAVGRYLLKIH
IDSFQGSVTAYQLGEFILLFNPWCPEDAVYLDSEPQRQEYVMNDYGFIYQGSKNWIRPCP
WNYGQFEEKIIDICLKLLDKSLHFQTDPATDCALRGSPVYVSRVVCAMINSNDDNGVLNG
NWSENYTDGANPAEWTGSVAILKQWYATGCQPVRYGQCWVFAAVMCTVMRCLGIPTRVIT
NFDSGHDTDGNLIIDEYYDNTGRILGNKKKDTIWNFHVWNECWMARKDLPPGYGGWQVLD
ATPQEMSNGVYCCGPASVRAIKEGEVDLNYDTPFVFSMVNADCMSWLVQGGKEQKLHQDT
SSVGNFISTKSIQSDERDDITENYKYEEGSLQERQVFLKALQKLKAGSFHSSQRGAELQP
SRPTPLSRDSPRSLHTPSLRPSDVVQVSLKFKLLDPPNMGQDICFVLLALNVSSQFKDLK
VNLSAQSLLHDGSPLSPFWQDTAFITLSPKEAKTYPCKISYSQYSQYLSTDKLIRISALG
EEKSSPEKILVNKIITLSYPSITINVLGAAVVNQPLSIQVIFSNPLSEQVEDCVLTVEGS
GLFKKQQKVLLGVLKPQHRASIILETVPFKSGQRQIQANMRSNKFKDIKGYRNVYVDFAL
NT seq 2163 nt NT seq  +upstreamnt  +downstreamnt
atggcccaagggcttgaagtggccctcacagacctccagagctccagaaataatgtgcgg
caccacacggaagagatcactgttgaccacctccttgttcgccggggccaggccttcaac
ctcaccctgtacttcaggaaccggggcttccagccaggcctggacaacatcatcttcgtg
gttgagactggaccactgccagacctggccttggggactcgggctgtgttcagcctggca
cgccatcacagccccagtccctggatcgcctggctggagaccaatggggccacctccaca
gaagtgagcttgtgcgctcctcccacggcggccgtgggtcggtacctcttgaaaatccac
atcgactccttccaggggtctgtgacggcctaccagctcggggagttcatcctgctcttc
aatccctggtgcccggaggatgctgtctacttggacagtgagccccagaggcaggagtat
gtcatgaatgattatggcttcatctaccaaggcagcaagaactggatccgcccgtgtccc
tggaactacggacagtttgaagagaaaatcatagacatctgcctgaagctgctggacaag
agcctgcacttccagactgacccagccacagactgtgccctgcggggaagccccgtctac
gtcagcagagtggtgtgtgccatgatcaacagcaatgatgacaatggggtgctcaatgga
aactggagtgagaattacacagatggcgccaaccctgcagagtggacgggcagcgtggcc
atcctgaagcagtggtatgccacaggctgccagcctgtgcgctatgggcagtgctgggtc
tttgctgccgtcatgtgcacagtgatgaggtgcctggggatccccacccgtgtgatcacc
aacttcgactctggccacgacacagatggaaacctgatcatagacgagtattatgacaac
acgggccggattttggggaataagaagaaggatactatctggaacttccatgtctggaat
gagtgctggatggcccggaaggatctgccccctggatatggaggctggcaggtgctggac
gccacacctcaggagatgagcaacggcgtctactgctgcggccctgcctctgtcagagcc
atcaaagaaggagaagtggacctgaactacgacacgccctttgtgttttcgatggtgaat
gctgactgcatgtcctggctcgtccagggagggaaggagcagaaacttcaccaggacacg
agttctgttggcaattttatcagcacaaagagcatccagagtgatgagcgggatgacatc
acagagaactacaagtacgaagaaggttccctccaggagaggcaggtgtttctgaaggct
ctgcagaagctgaaggctggaagtttccatagctcccaaagaggagcagagttgcaacct
tccaggcccaccccactgagccgggacagccctcggagcctgcatacaccttcccttcga
cccagtgatgtggtccaagtctccctgaaattcaagctgctcgacccgcccaacatgggc
caagatatatgctttgtcctgctggccctcaacgtgtcctcccagttcaaggacctcaaa
gtgaacctgagtgcccagtctctgctgcacgatggcagccccctgtccccattctggcag
gacacagcgttcatcacactctctcctaaagaagcaaagacctacccctgcaaaatctcc
tattcccagtacagccagtacctgtcaacagacaagctgatccgcatcagtgccttgggt
gaagagaaaagcagtcccgagaaaatcctggtgaacaagatcatcaccttatcttatccg
agcatcacgattaatgttctaggagcagccgttgtgaaccagccgctctccatacaggtg
atattttcaaaccccctctcggagcaggttgaggactgtgtgctgaccgtggaaggaagc
ggcctcttcaagaaacagcagaaagtcctccttggagtcctcaaaccccaacatcgagcg
agcatcattctggagaccgtccccttcaagagtggccaaaggcagatccaagctaatatg
agaagcaacaagtttaaggacatcaagggttacaggaatgtttatgtagactttgcatta
taa

DBGET integrated database retrieval system