KEGG   Macaca fascicularis (crab-eating macaque): 102129830
Entry
102129830         CDS       T02918                                 

Gene name
IL2, IL-2, TCGF
Definition
(RefSeq) interleukin 2
  KO
K05429  interleukin 2
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04060  Cytokine-cytokine receptor interaction
mcf04061  Viral protein interaction with cytokine and cytokine receptor
mcf04151  PI3K-Akt signaling pathway
mcf04625  C-type lectin receptor signaling pathway
mcf04630  JAK-STAT signaling pathway
mcf04658  Th1 and Th2 cell differentiation
mcf04659  Th17 cell differentiation
mcf04660  T cell receptor signaling pathway
mcf04672  Intestinal immune network for IgA production
mcf04940  Type I diabetes mellitus
mcf05135  Yersinia infection
mcf05142  Chagas disease
mcf05162  Measles
mcf05166  Human T-cell leukemia virus 1 infection
mcf05200  Pathways in cancer
mcf05320  Autoimmune thyroid disease
mcf05321  Inflammatory bowel disease
mcf05330  Allograft rejection
mcf05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102129830 (IL2)
   04151 PI3K-Akt signaling pathway
    102129830 (IL2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102129830 (IL2)
   04061 Viral protein interaction with cytokine and cytokine receptor
    102129830 (IL2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    102129830 (IL2)
   04660 T cell receptor signaling pathway
    102129830 (IL2)
   04658 Th1 and Th2 cell differentiation
    102129830 (IL2)
   04659 Th17 cell differentiation
    102129830 (IL2)
   04672 Intestinal immune network for IgA production
    102129830 (IL2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102129830 (IL2)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    102129830 (IL2)
   05321 Inflammatory bowel disease
    102129830 (IL2)
   05330 Allograft rejection
    102129830 (IL2)
   05332 Graft-versus-host disease
    102129830 (IL2)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    102129830 (IL2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    102129830 (IL2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102129830 (IL2)
   05162 Measles
    102129830 (IL2)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    102129830 (IL2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcf04052]
    102129830 (IL2)
   00536 Glycosaminoglycan binding proteins [BR:mcf00536]
    102129830 (IL2)
Cytokines and growth factors [BR:mcf04052]
 Cytokines
  Interleukins
   102129830 (IL2)
Glycosaminoglycan binding proteins [BR:mcf00536]
 Heparan sulfate / Haparin
  Cytokines
   102129830 (IL2)
SSDB
Motif
Pfam: IL2 Plasmid_RAQPRD
Other DBs
NCBI-GeneID: 102129830
NCBI-ProteinID: NP_001271628
UniProt: Q29615
LinkDB
Position
5
AA seq 154 aa
MYRMQLLSCIALSLALVTNSAPTSSSTKKTQLQLEHLLLDLQMILNGINNYKNPKLTRML
TFKFYMPKKATELRHLQCLEEELKPLEEVLNLAQSKSFHLRDTKDLISNINVIVLELKGS
ETTLMCEYADETATIVEFLNRWITFCQSIISTLT
NT seq 465 nt   +upstreamnt  +downstreamnt
atgtacaggatgcaactcctgtcttgcattgcactaagtcttgcacttgtcacaaacagt
gcacctacttcaagttctacaaagaaaacacagctacaactggagcatttactgctggat
ttacagatgattttgaatggaattaataattacaagaatcccaaactcaccaggatgctc
acatttaagttttacatgcccaagaaggccacagaattgagacatcttcagtgtctagaa
gaagaactcaaacctctggaggaagtgctaaatttagctcaaagcaaaagctttcactta
agagataccaaggacttaatcagcaatatcaacgtaatagttctggaactaaagggatct
gaaacaacactgatgtgtgaatatgctgatgagacagcaaccattgtagaatttctgaac
agatggattaccttttgtcaaagcatcatctcaacactgacctga

DBGET integrated database retrieval system