KEGG   Macaca fascicularis (crab-eating macaque): 102130525
Entry
102130525         CDS       T02918                                 

Gene name
AIM2
Definition
(RefSeq) absent in melanoma 2
  KO
K12966  absent in melanoma 2
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04621  NOD-like receptor signaling pathway
mcf04623  Cytosolic DNA-sensing pathway
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    102130525 (AIM2)
   04623 Cytosolic DNA-sensing pathway
    102130525 (AIM2)
SSDB
Motif
Pfam: HIN PYRIN tRNA_anti-codon Rep-A_N
Other DBs
NCBI-GeneID: 102130525
NCBI-ProteinID: XP_005541374
UniProt: A0A2K5UY51
LinkDB
Position
1
AA seq 343 aa
MESKYKEILLLTGLDNITDEELDRFKFFLSDEFNIATGILRTANRIQVANLMIQNAGAVT
AVKKTILIFQKLNYMLLVKRLKEEKEKVDKEYKSVTKPKPLSQPEMSPAASAAVRNDVTK
QRAAPKVSPHVKPEQKQRVAQQESIREEFRKDCLPVMVLKATKPFTFETQEGKQEMFHAT
VATEKEFFFVKVFNTLLKDKFIPKRMIIISRYYQHSGFLEVNSASCVLDAKSDQKVDVPL
NIIRKAGETPKINTLQTQPLGTIVNGLFVVQKVTEKKKNVLFDLSDKTGEMEVLVVRNED
TMQCKEGDKVRLTFFTLSKNGEKPQLTSGVHSTIKVIKASKKT
NT seq 1032 nt   +upstreamnt  +downstreamnt
atggagagtaaatacaaggagatactcttgctaacgggcctggataacatcactgatgag
gaactggataggtttaagttctttctttcagacgagtttaatatcgccacaggcatacta
cgtaccgcaaacagaatacaagtagctaacttgatgattcaaaatgctggtgcagtgact
gcagtgaagaagaccattcttatttttcagaagttgaattatatgcttttggtaaaacgt
cttaaggaagagaaggagaaagttgataaggaatacaaatcggtaacaaaaccaaagcca
ctaagtcaacctgaaatgagtcctgctgcatctgcagccgtcagaaatgatgtcacaaag
caacgtgctgcaccaaaagtctctcctcatgttaagcctgagcagaaacagagggtggcc
cagcaggaatctatcagagaagagtttcggaaagactgtttgccagttatggtactgaaa
gcaacaaagcccttcacgtttgagacccaagaaggcaagcaagagatgtttcatgctacg
gtggctacagagaaggaattcttctttgtaaaagtttttaatacactgctgaaagataaa
ttcattccaaagagaatgattataatatcaagatattatcagcacagtggtttcttagag
gtaaatagcgcctcatgtgtgttagatgctaaatctgaccaaaaggttgatgtcccgctg
aacattatcagaaaagctggtgaaaccccaaagatcaacacgcttcaaactcagcccctt
ggaacaattgtgaatgggttgtttgtagtccagaaggtaacagaaaagaagaaaaatgta
ttatttgacctaagtgacaagactggggaaatggaagtattggtggttagaaacgaggac
acaatgcaatgtaaggaaggagataaggttcgacttacattcttcacactgtcaaaaaat
ggagaaaaaccacagctgacatctggagttcatagcaccataaaggttattaaggccagt
aaaaaaacatag

DBGET integrated database retrieval system