KEGG   Macaca fascicularis (crab-eating macaque): 102132615Help
Entry
102132615         CDS       T02918                                 

Gene name
TMPRSS9
Definition
(RefSeq) transmembrane protease, serine 9
  KO
K09640  transmembrane protease serine 9 [EC:3.4.21.-]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Brite
Enzymes [BR:mcf01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     102132615 (TMPRSS9)
Peptidases [BR:mcf01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   102132615 (TMPRSS9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin DUF1986 Ldl_recept_a
Motif
Other DBs
NCBI-GeneID: 102132615
NCBI-ProteinID: XP_015295664
LinkDB All DBs
Position
19
AA seq 1009 aa AA seqDB search
MGSRGCQRFWGLANGFGHCPAGLHGPKHLVVRVVAAALQFVSSFQKTELEASCVGCTVLN
YRDGNSSVLVHFRLRFLLRPLQTLSLGLEEELLQRGIQARLRERGISLAAYGTIVSAELT
DAAXGQKVHSFLFSGHCPGNSFSCQNSQCVTKVNPECDDQEDCSDGSDEVHCECGLQPAW
RMAGRIVGGVEASPGEFPWQASLRENKEHFCGATIISARWLVSAAHCFNEFQDPTEWVAY
VGTTYLSGSEASTVRARVAQIIKHPLYNADTADFDVAVLELTSPLPFGRHIQPVCLPAAT
HIFPPSKKCLISGWGYLKEDFLVKPEVLQKATVELLDQALCASLYGHSLTDRMLCAGYLD
GKVDSCQVSPRCPRPQKNTEIDRSVFKCCAIQRYLDVRPRDCGTFRAWLQLVSWDPTHPH
APIRAGQDPQTWSCVPLPECGARPAMEKPTRVVGGFGAASGEVPWQVSLKEGSRHFCGAT
VVGDRWLLSAAHCFNHTKVEQVRAHLGTASLLGLGGSPVKIGLRRVVLHPLYNPGILDFD
LAVLELASPLAFNKYIQPVCLPLAIQKFPVGRKCMISGWGNMQEGNATKPELLQKASVGI
IDQKTCSVLYNFSLTDRMICAGFLEGKVDSCQGDSGGPLACEEAPGVFYLAGIVSWGIGC
AQVKKPGVYTRITRLKGWILEIMSSQPLPVSPPSTTRTLATTSHPPRTTAGLTVPGATPS
RPTPGAASRVTGQPANSALSAMSTTARGQMPFPDALEATTHSQLPDCGLAPVALSRIVGG
SAAGRGEWPWQVSLWLRRREHRCGAVLVAERWLLSAAHCFDVYGDPKQWAAFLGTPFLSG
AEGQLERVARIYKHPFYNLYTLDYDVALLELAGPVRRSRLVRPICLPEPVPRPPDGARCV
ITGWGSVREGGSMARQLQKAAVRLLSEQTCRRFYPVQISSRMLCAGFPQGGVDSCSGDAG
GPLACREPSGRWVLTGVTSWGYGCGRPHFPGVYTRVAAVRGWIGQHIQE
NT seq 3030 nt NT seq  +upstreamnt  +downstreamnt
atgggctcccggggttgccaaaggttttggggacttgccaacgggttcgggcactgcccc
gcgggacttcatggccccaaacaccttgtggtccgcgtggtggccgccgccttgcagttt
gtaagtagttttcagaagacagagttagaggcaagctgcgtgggttgcacggtgctgaat
tacagggatgggaactccagtgtcctcgtacatttccggttgcgctttctgctgcgaccc
ctccagacgctgagcctgggcctggaggaggagctattgcagagagggatccaggcaagg
ctgcgagagcgcggtatctccctggctgcctatggcacaatcgtgtcggccgagctcaca
gatgcagcatgaggtcagaaagttcattcttttttgttctcaggccactgtccagggaac
tccttttcctgccagaacagccagtgtgtgaccaaggtgaacccggagtgtgacgaccag
gaggactgctccgatgggtccgatgaggtgcactgtgagtgtggcttgcagcctgcctgg
aggatggccggcaggatcgtgggtggtgtggaagcgtccccgggggagtttccgtggcaa
gccagccttcgagagaacaaggagcacttctgtggggccaccatcatcagtgccaggtgg
ctggtatctgccgctcactgcttcaatgaattccaagacccgacagagtgggtggcctac
gtgggtacgacctacctcagtggctcggaggccagcaccgtgcgggcccgggtggcccag
atcatcaagcaccccctgtacaacgcagacacggccgacttcgacgtggcagtgctggag
ctgaccagccctctgcctttcggccggcacatccagcccgtgtgcctcccggctgccaca
cacatcttcccacccagcaagaagtgcctgatctcaggctggggctacctcaaggaggat
ttcctggtcaagccagaggtgctgcagaaagccactgtggaactgctggaccaggcactg
tgtgccagcctgtacggccactcactcactgacaggatgttgtgtgctggctacctggac
gggaaggtggactcctgccaggtgagcccccgatgccccagaccccagaaaaacacagaa
atagacaggagcgtgttcaaatgctgcgcaattcaaagatatctggatgtccgccccagg
gattgcggcacctttagggcctggctgcagttggtgtcctgggaccctacccacccccat
gctcccatccgagcaggccaagatccccagacctggtcttgtgtcccccttccagaatgt
ggggccaggcctgcaatggagaagcccacccgggtcgtgggcgggttcggagctgcctcc
ggggaggtgccctggcaggtcagcctgaaggaagggtcccggcacttctgtggagcgact
gtggtgggggaccgctggctgctgtctgccgcccactgcttcaaccacacaaaggtggag
caggttcgggcccacctgggcactgcgtccctcctgggcctgggcgggagcccggtgaag
atcgggctgcggcgggtggtgctacaccccctctacaaccctggcatcctggacttcgac
ctggctgtcctggagctggccagccccctggccttcaacaaatacatccagcctgtctgc
ctgcccctggccatccagaagttccctgtgggccggaagtgcatgatctccggatgggga
aatatgcaggaaggaaatgccaccaagcccgagctcctgcagaaggcgtccgtgggcatc
atagaccagaagacctgtagcgtgctctacaacttctccctcacagaccgcatgatctgc
gctggcttcctggaaggcaaagttgactcctgccagggtgactctgggggccccctggcc
tgcgaggaggcccccggcgtgttttatctggcagggattgtgagctggggtattggctgc
gctcaggttaagaagccgggcgtctacacgcgcatcaccaggctaaagggctggatcctg
gagatcatgtcttcccagccccttcccgtgtctcccccctcgaccacaaggacactggcc
accaccagccatccccccaggacgacagctggcctcacagtcccgggggccacacccagc
agacccacccctggggccgccagcagggtgacgggccaacctgccaactcagccttatct
gccatgagcaccactgctaggggacagatgccatttccagatgccctggaggccaccacg
cactcccagctaccagactgcggcctggcgccggtggcgctcagcaggattgtgggtggc
agcgcagcgggccgcggggagtggccgtggcaggtgagcctgtggctgcggcgccgggaa
caccgctgtggggccgtgctggtggcagagaggtggctgctgtcggcggcgcactgcttc
gacgtctacggggaccccaagcagtgggcagccttcctaggcacgccgttcctgagcggc
gcggaggggcagctggagcgcgtggcgcgcatctacaagcacccgttctacaatctctac
acgctcgactacgacgtggcgctgctggagctggcggggccggtgcgccgcagccgcctg
gtgcgtcccatctgcctgcccgagcccgtgccgcgacccccagacggtgcgcgctgcgtc
atcaccggctggggctcggtgcgcgaaggaggctccatggcgcggcagctgcagaaggcg
gccgtgcgcctcctcagcgagcagacctgccgccgcttctacccggtgcagatcagcagc
cgcatgctgtgtgccggcttcccgcagggcggcgtggacagctgctcgggtgacgctggg
ggacccctggcctgcagggagccgtctggacgatgggtgctaactggggtcaccagctgg
ggctatggctgcggccggccccacttcccaggtgtctatacccgggtggcagctgtgaga
ggctggataggacagcacatccaggagtga

DBGET integrated database retrieval system