KEGG   Macaca fascicularis (crab-eating macaque): 102134439Help
Entry
102134439         CDS       T02918                                 

Gene name
GYS1
Definition
(RefSeq) glycogen synthase 1
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf00500  Starch and sucrose metabolism
mcf01100  Metabolic pathways
mcf04151  PI3K-Akt signaling pathway
mcf04152  AMPK signaling pathway
mcf04910  Insulin signaling pathway
mcf04922  Glucagon signaling pathway
mcf04931  Insulin resistance
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    102134439 (GYS1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    102134439 (GYS1)
   04152 AMPK signaling pathway
    102134439 (GYS1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    102134439 (GYS1)
   04922 Glucagon signaling pathway
    102134439 (GYS1)
 09160 Human Diseases
  09166 Endocrine and metabolic diseases
   04931 Insulin resistance
    102134439 (GYS1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:mcf01003]
    102134439 (GYS1)
Enzymes [BR:mcf01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     102134439 (GYS1)
Glycosyltransferases [BR:mcf01003]
 Polysaccharide
  Storage polysaccharide
   102134439 (GYS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glyco_transf_4 Glyco_transf_5 Glycos_transf_1 Glyco_trans_4_4 Glyco_trans_1_4
Motif
Other DBs
NCBI-GeneID: 102134439
NCBI-ProteinID: XP_005589894
UniProt: A0A2K5U886
LinkDB All DBs
Position
19
AA seq 737 aa AA seqDB search
MPLNRTLSMSSLPGLEDWEDEFDLENTVLFEVAWEVANKVGGIYTVLQTKAKVTGDEWGD
NYYLVGPYTEQGVRTQVELLEAPTPALKKTLDSMNSKGCKVYFGRWLIEGGPLVVLLDVG
ASAWALERWKGELWDTCNIGVPWYDREANDAVLFGFLTTWFLGEFLAQSEEKPHVVAHFH
EWLAGIGLCLCRARRLPVATIFTTHATLLGRYLCAGAVDFYNNLENFNVDKEAGERQIYH
RYCMERAAAHCAHVFTTVSQITAIEAQHLLKRKPDIVTPNGLNVKKFSAMHEFQNLHAQS
KARIQEFVRGHFYGHLDFNLDKTLYFFIAGRYEFSNKGADVFLEALARLNYLLRVNGSEQ
TVVAFFIMPARTNNFNVETLKGQAVRKQLWDTANTVKEKFGRKLYESLLVGSLPDMNKML
DKEDFTMMKRAIFATQRQSFPPVCTHNMLDDSSDPILTTIRRIGLFNSSADRVKVIFHPE
FLSSTSPLLPVDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSISTNLSGFGCFMEE
HIADPSAYGIYILDRRFRSLDDSCSQLTSFLYSFCQQSRRQRIIQRNRTERLSDLLDWKY
LGRYYMSARHMALSKAFPEHFTYEPSEADAAQGYRYPRPASVPPSPSLSRHSSPHQSEDE
EDPRNGPLEEDSERYDEDEEAAKDRRNIRAPEWPRRASCTSSTSGSKRNSVDTATSSSLS
TPSEPLSPTSSLGEERN
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
atgcctttaaaccgcactttgtccatgtcctcactgccaggactggaggactgggaggat
gaattcgacctggagaacacagtgctcttcgaagtggcctgggaggtggccaacaaggtg
ggtggcatctacacggtgctgcagacgaaggcgaaggtgacgggggacgaatggggcgac
aactactacctggtggggccgtacacggagcagggcgtgaggacccaggtggaactgctg
gaggcccccaccccggccctgaagaagacactggattccatgaacagcaagggttgcaag
gtgtattttgggcgctggttgatcgagggaggccctctggtggtgctcctggatgtgggg
gcctcagcctgggccctggagcgctggaagggagagctctgggatacctgcaacatcgga
gtgccgtggtacgaccgcgaggccaacgatgctgtcctctttggctttctcactacctgg
ttcctgggtgagttcctcgcgcagagtgaggagaagccacacgtggttgctcacttccat
gagtggttggcaggcattggactctgcctgtgtcgtgcccggcgactgcctgtagcaacc
atcttcaccacccatgccacgctgctggggcgctacctgtgtgccggtgctgtggacttc
tacaacaacctggagaacttcaacgtggacaaggaagcaggggagaggcagatctatcac
cgctactgcatggaaagggcggcagcccactgtgctcacgtcttcactactgtgtcccag
atcaccgccatcgaggcacagcacttgctcaagaggaaaccagatattgtgacccccaat
gggctgaatgtgaagaagttttctgccatgcatgagttccagaacctccatgctcagagc
aaggctcgaatccaggagtttgtgcggggccatttttatgggcatctggacttcaacttg
gacaagaccttgtacttctttatcgccggccgctatgagttctccaacaagggtgccgac
gtcttcctggaggccttggcccggctcaactatctgctcagagtgaatggcagcgagcag
acagtggttgccttcttcatcatgccggcgcggaccaacaatttcaacgtggaaaccctc
aaaggccaagccgtgcgcaaacagctttgggacacggccaacacggtgaaggagaagttc
gggaggaagctttatgaatccttactggttgggagccttcctgacatgaacaagatgctg
gataaggaagacttcactatgatgaagagagccatctttgcaacgcagcggcagtctttc
ccccctgtgtgcacccacaatatgctggatgactcctcagaccccatcctgaccaccatc
cgccgaatcggcctcttcaatagcagtgccgacagggtgaaggtgattttccacccggag
ttcctctcctccacaagccccctgctcccggtggactatgaggagtttgtccgtggctgt
caccttggggtcttcccatcctactatgagccttggggctatacgccggctgagtgcacg
gttatgggcatccccagtatctccaccaatctctccggcttcggctgcttcatggaggaa
cacatcgcagacccctcagcttacggtatctacattctcgaccggcggttccgcagcctg
gatgattcctgctcgcagctcacctccttcctctacagcttctgtcagcagagccggcgg
cagcgtatcatccagcggaaccgcacggagcgcctctccgaccttctggactggaaatac
ctaggccggtactatatgtctgcgcgccacatggcgctgtccaaggcctttccagagcac
ttcacctacgagcccagcgaggcagatgcggcccaagggtaccgctacccacggccggcc
tcggtgccaccgtcgccctcgctgtcacgacactccagcccgcaccagagcgaggacgag
gaggatccccggaacgggcctctggaggaagacagcgagcgctacgatgaggacgaggag
gccgccaaggaccggcgcaacattcgtgcaccagagtggccgcgccgagcgtcctgcacc
tcctccaccagtgggagcaagcgcaactctgtggacacggccacctccagctcgctcagc
acccccagcgagcccctcagccccaccagctccctgggcgaggagcgtaactaa

DBGET integrated database retrieval system