KEGG   Macaca fascicularis (crab-eating macaque): 102134593
Entry
102134593         CDS       T02918                                 

Gene name
FGF1
Definition
(RefSeq) fibroblast growth factor 1
  KO
K18496  fibroblast growth factor 1
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04010  MAPK signaling pathway
mcf04014  Ras signaling pathway
mcf04015  Rap1 signaling pathway
mcf04151  PI3K-Akt signaling pathway
mcf04390  Hippo signaling pathway
mcf04810  Regulation of actin cytoskeleton
mcf05200  Pathways in cancer
mcf05218  Melanoma
mcf05224  Breast cancer
mcf05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102134593 (FGF1)
   04014 Ras signaling pathway
    102134593 (FGF1)
   04015 Rap1 signaling pathway
    102134593 (FGF1)
   04390 Hippo signaling pathway
    102134593 (FGF1)
   04151 PI3K-Akt signaling pathway
    102134593 (FGF1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102134593 (FGF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102134593 (FGF1)
  09162 Cancer: specific types
   05226 Gastric cancer
    102134593 (FGF1)
   05218 Melanoma
    102134593 (FGF1)
   05224 Breast cancer
    102134593 (FGF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcf04052]
    102134593 (FGF1)
   00536 Glycosaminoglycan binding proteins [BR:mcf00536]
    102134593 (FGF1)
Cytokines and growth factors [BR:mcf04052]
 Growth factors
  Growth factors (RTK binding)
   102134593 (FGF1)
Glycosaminoglycan binding proteins [BR:mcf00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   102134593 (FGF1)
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 102134593
NCBI-ProteinID: XP_005558156
UniProt: A0A2K5UVN3 G7P8J2
LinkDB
Position
6
AA seq 155 aa
MAEGEITTFTALTEKFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQ
LSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYTSKKHAEK
NWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
NT seq 468 nt   +upstreamnt  +downstreamnt
atggctgaaggggaaatcaccacgttcacagccctgaccgagaagtttaatctgcctcca
gggaattacaagaagcccaaactgctctactgtagcaatgggggccacttcttgaggatc
cttccggatggcacagtggatgggacaagggacaggagcgaccagcacattcagctgcag
ctcagtgcggaaagcgtgggggaggtgtatataaagagtaccgagactggccagtacttg
gccatggacaccgacgggcttttatacggctcacagacaccaaatgaggaatgtttgttc
ctggaaaggctggaggagaaccattacaacacctatacatccaagaagcacgcagagaag
aattggtttgttggcctcaagaagaatggaagctgcaaacgtggtcctcggactcactat
ggccagaaagcaatcttgtttcttcccctgccagtctcttctgattaa

DBGET integrated database retrieval system