KEGG   Macaca fascicularis (crab-eating macaque): 102135329
Entry
102135329         CDS       T02918                                 

Gene name
CCND1
Definition
(RefSeq) cyclin D1
  KO
K04503  G1/S-specific cyclin-D1
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf01522  Endocrine resistance
mcf04068  FoxO signaling pathway
mcf04110  Cell cycle
mcf04115  p53 signaling pathway
mcf04151  PI3K-Akt signaling pathway
mcf04152  AMPK signaling pathway
mcf04218  Cellular senescence
mcf04310  Wnt signaling pathway
mcf04340  Hedgehog signaling pathway
mcf04371  Apelin signaling pathway
mcf04390  Hippo signaling pathway
mcf04510  Focal adhesion
mcf04530  Tight junction
mcf04630  JAK-STAT signaling pathway
mcf04917  Prolactin signaling pathway
mcf04919  Thyroid hormone signaling pathway
mcf04921  Oxytocin signaling pathway
mcf04933  AGE-RAGE signaling pathway in diabetic complications
mcf04934  Cushing syndrome
mcf05160  Hepatitis C
mcf05162  Measles
mcf05163  Human cytomegalovirus infection
mcf05165  Human papillomavirus infection
mcf05166  Human T-cell leukemia virus 1 infection
mcf05167  Kaposi sarcoma-associated herpesvirus infection
mcf05169  Epstein-Barr virus infection
mcf05200  Pathways in cancer
mcf05203  Viral carcinogenesis
mcf05205  Proteoglycans in cancer
mcf05206  MicroRNAs in cancer
mcf05210  Colorectal cancer
mcf05212  Pancreatic cancer
mcf05213  Endometrial cancer
mcf05214  Glioma
mcf05215  Prostate cancer
mcf05216  Thyroid cancer
mcf05218  Melanoma
mcf05219  Bladder cancer
mcf05220  Chronic myeloid leukemia
mcf05221  Acute myeloid leukemia
mcf05222  Small cell lung cancer
mcf05223  Non-small cell lung cancer
mcf05224  Breast cancer
mcf05225  Hepatocellular carcinoma
mcf05226  Gastric cancer
mcf05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    102135329 (CCND1)
   04340 Hedgehog signaling pathway
    102135329 (CCND1)
   04390 Hippo signaling pathway
    102135329 (CCND1)
   04371 Apelin signaling pathway
    102135329 (CCND1)
   04630 JAK-STAT signaling pathway
    102135329 (CCND1)
   04068 FoxO signaling pathway
    102135329 (CCND1)
   04151 PI3K-Akt signaling pathway
    102135329 (CCND1)
   04152 AMPK signaling pathway
    102135329 (CCND1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102135329 (CCND1)
   04115 p53 signaling pathway
    102135329 (CCND1)
   04218 Cellular senescence
    102135329 (CCND1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102135329 (CCND1)
   04530 Tight junction
    102135329 (CCND1)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    102135329 (CCND1)
   04921 Oxytocin signaling pathway
    102135329 (CCND1)
   04919 Thyroid hormone signaling pathway
    102135329 (CCND1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102135329 (CCND1)
   05206 MicroRNAs in cancer
    102135329 (CCND1)
   05205 Proteoglycans in cancer
    102135329 (CCND1)
   05203 Viral carcinogenesis
    102135329 (CCND1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102135329 (CCND1)
   05212 Pancreatic cancer
    102135329 (CCND1)
   05225 Hepatocellular carcinoma
    102135329 (CCND1)
   05226 Gastric cancer
    102135329 (CCND1)
   05214 Glioma
    102135329 (CCND1)
   05216 Thyroid cancer
    102135329 (CCND1)
   05221 Acute myeloid leukemia
    102135329 (CCND1)
   05220 Chronic myeloid leukemia
    102135329 (CCND1)
   05218 Melanoma
    102135329 (CCND1)
   05219 Bladder cancer
    102135329 (CCND1)
   05215 Prostate cancer
    102135329 (CCND1)
   05213 Endometrial cancer
    102135329 (CCND1)
   05224 Breast cancer
    102135329 (CCND1)
   05222 Small cell lung cancer
    102135329 (CCND1)
   05223 Non-small cell lung cancer
    102135329 (CCND1)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    102135329 (CCND1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102135329 (CCND1)
   04934 Cushing syndrome
    102135329 (CCND1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102135329 (CCND1)
   05162 Measles
    102135329 (CCND1)
   05160 Hepatitis C
    102135329 (CCND1)
   05163 Human cytomegalovirus infection
    102135329 (CCND1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102135329 (CCND1)
   05169 Epstein-Barr virus infection
    102135329 (CCND1)
   05165 Human papillomavirus infection
    102135329 (CCND1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102135329 (CCND1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 102135329
NCBI-ProteinID: XP_005577039
UniProt: A0A2K5TKJ8
LinkDB
Position
14
AA seq 295 aa
MEHQLLCCEVETIRRAYPDANLLNDRVLRAMLKAEETCAPSVSYFKCVQKEVLPSMRKIV
ATWMLEVCEEQKCEEEVFPLAMNYLDRFLSLEPVKKSRLQLLGATCMFVASKMKETIPLT
AEKLCIYTDNSIRPEELLQMELLLVNKLKWNLAAMTPHDFIEHFLSKMPEAEENKQIIRK
HAQTFVALCATDVKFISNPPSMVAAGSVVAAVQGLNLGSPNNFLSYYRLTRFLSRVIKCD
PDCLRACQEQIEALLESSLRQAQQNMDPKAAEEEEEEEEEVDLACTPTDVRDVDI
NT seq 888 nt   +upstreamnt  +downstreamnt
atggaacaccagctcctgtgctgcgaagtggaaaccatccgccgcgcgtaccccgatgcc
aacctcctcaacgaccgggtgctgcgggccatgctgaaggcggaggagacctgcgcgccc
tcggtgtcctacttcaaatgtgtgcagaaggaggtcctgccgtccatgcggaagatcgtc
gccacctggatgctggaggtctgcgaggagcagaagtgcgaggaggaggtcttcccgctg
gccatgaactacctggaccgcttcctgtcgctggagcccgtgaaaaagagccgcctgcag
ctgctgggggccacctgcatgttcgtggcctctaagatgaaggagaccatccccctgacg
gccgagaagctgtgcatctacaccgacaactccatccggcccgaagagctgctgcaaatg
gagctgctcctggtgaacaagctcaagtggaacctggccgccatgaccccgcacgatttc
atcgaacacttcctttccaaaatgccagaggcggaggagaacaaacagatcatccgcaaa
cacgctcagaccttcgttgccctctgtgccacagatgtgaagttcatttccaatccaccc
tccatggtggcagcagggagcgtggtggccgcagtgcaaggcctgaacctggggagcccc
aacaacttcctgtcctactaccgcctcacacgcttcctctccagagtgatcaagtgtgac
ccggactgcctccgggcctgccaggagcagatcgaagccctgctggagtcaagcctgcgc
caggcccagcagaacatggaccccaaggccgccgaggaggaggaagaggaggaggaggag
gtggacctggcttgcacacccaccgacgtgcgggatgtggacatctga

DBGET integrated database retrieval system