KEGG   Macaca fascicularis (crab-eating macaque): 102136014Help
Entry
102136014         CDS       T02918                                 

Gene name
SUV39H2
Definition
(RefSeq) suppressor of variegation 3-9 homolog 2
  KO
K11419  histone-lysine N-methyltransferase SUV39H [EC:2.1.1.43]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:mcf00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    102136014 (SUV39H2)
Enzymes [BR:mcf01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     102136014 (SUV39H2)
Chromosome and associated proteins [BR:mcf03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     102136014 (SUV39H2)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    102136014 (SUV39H2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET Pre-SET Chromo
Motif
Other DBs
NCBI-GeneID: 102136014
NCBI-ProteinID: NP_001306534
UniProt: Q4R3E0
LinkDB All DBs
Position
9
AA seq 445 aa AA seqDB search
MAAVGAEARGAWCVPCLVSLDTLQELCRKEKLTCKSIGITKRNLNNYEVEYLCDYKVVKD
MEYYLVKWKGWPDSTNTWEPLQNLKCPLLLQQFSNDKHNYLSQVKKGKAITPKNNNKTLK
PAIAEYIVKKAKQRIALQRWQDELNRRKNHKGMIFVENTVDLEGPPSDFYYINEYKPAPG
ISLVNEATFGCSCTDCFFQKCCPAEAGVLLAYNKNQQIKIPPGTPIYECNSRCQCGPDCP
NRIVQKGTQYSLCIFRTSNGRGWGVKTLVKIKRMSFVMEYVGEVITSEEAERRGQFYDNK
GITYLFDLDYESDEFTVDAARYGNVSHFVNHSCDPNLQVFNVFIDNLDTRLPRIALFSTR
TINAGEELTFDYQMKGSGDISSDSIDHSPAKKRVRTVCKCGAVTCRGYLNWTFSGNRADD
YNFFPNVNIFKNTYLGLLLSRLYLC
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggtcggggccgaggcgcgaggagcttggtgtgtgccttgcctagtttcactt
gatactcttcaggaattatgtagaaaagaaaagctcacatgtaaatcgattggaatcacc
aaaaggaatctaaacaattatgaggtggaatacttgtgtgactacaaggtagtaaaggat
atggaatattatcttgtaaaatggaaaggatggccagattctacaaatacttgggaacct
ttgcaaaatctgaagtgcccgttactgcttcagcaattctctaatgacaagcataactat
ttatctcaggtaaagaaaggcaaagcaataactccgaaaaacaataacaaaactttgaaa
cctgccatcgctgagtacattgtgaagaaggctaaacaaaggatagctctgcagagatgg
caagatgaactcaacagaaggaagaatcataaaggaatgatatttgttgaaaatactgtt
gatttagagggcccaccttcagacttctattacattaacgaatacaaaccagctcctgga
atcagcttagtcaatgaagctacctttggttgttcgtgcacagattgcttctttcaaaaa
tgttgtcctgctgaagctggagttcttttggcttataataaaaaccaacaaattaaaatc
ccacctggtactcccatctatgaatgcaactcaaggtgtcaatgtggacctgattgtccc
aataggattgtacaaaaaggcacacagtattcgctttgcatttttcgaactagcaatgga
cgtggctggggtgtgaagacccttgtgaagattaaaagaatgagttttgtcatggaatat
gttggagaggtaatcacaagtgaagaagctgaaagacggggacagttctatgacaacaag
ggaatcacgtatctctttgatctggactatgaatctgatgaattcacagtggatgcggct
cgatacggcaatgtgtctcattttgtgaatcacagctgtgacccaaatcttcaggtgttc
aatgttttcattgataacctcgatactcgtcttccccgaatagcattgttttccacgaga
acgataaatgctggagaagagctgacttttgattatcaaatgaaaggttctggagatata
tcttcagattctattgaccacagcccagccaaaaagagggtcagaacagtatgtaaatgt
ggagctgtgacttgcagaggttacctcaactggactttttcaggaaatagagctgatgat
tataattttttccccaatgttaacatttttaaaaatacatatttgggactcttattatca
agattgtacctatgttaa

DBGET integrated database retrieval system