KEGG   Macaca fascicularis (crab-eating macaque): 102136063
Entry
102136063         CDS       T02918                                 

Gene name
CDKN1A
Definition
(RefSeq) cyclin dependent kinase inhibitor 1A
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf01522  Endocrine resistance
mcf01524  Platinum drug resistance
mcf04012  ErbB signaling pathway
mcf04066  HIF-1 signaling pathway
mcf04068  FoxO signaling pathway
mcf04110  Cell cycle
mcf04115  p53 signaling pathway
mcf04151  PI3K-Akt signaling pathway
mcf04218  Cellular senescence
mcf04630  JAK-STAT signaling pathway
mcf04921  Oxytocin signaling pathway
mcf04928  Parathyroid hormone synthesis, secretion and action
mcf04934  Cushing syndrome
mcf05160  Hepatitis C
mcf05161  Hepatitis B
mcf05163  Human cytomegalovirus infection
mcf05165  Human papillomavirus infection
mcf05166  Human T-cell leukemia virus 1 infection
mcf05167  Kaposi sarcoma-associated herpesvirus infection
mcf05169  Epstein-Barr virus infection
mcf05200  Pathways in cancer
mcf05202  Transcriptional misregulation in cancer
mcf05203  Viral carcinogenesis
mcf05205  Proteoglycans in cancer
mcf05206  MicroRNAs in cancer
mcf05210  Colorectal cancer
mcf05211  Renal cell carcinoma
mcf05212  Pancreatic cancer
mcf05213  Endometrial cancer
mcf05214  Glioma
mcf05215  Prostate cancer
mcf05216  Thyroid cancer
mcf05217  Basal cell carcinoma
mcf05218  Melanoma
mcf05219  Bladder cancer
mcf05220  Chronic myeloid leukemia
mcf05222  Small cell lung cancer
mcf05223  Non-small cell lung cancer
mcf05224  Breast cancer
mcf05225  Hepatocellular carcinoma
mcf05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102136063 (CDKN1A)
   04630 JAK-STAT signaling pathway
    102136063 (CDKN1A)
   04066 HIF-1 signaling pathway
    102136063 (CDKN1A)
   04068 FoxO signaling pathway
    102136063 (CDKN1A)
   04151 PI3K-Akt signaling pathway
    102136063 (CDKN1A)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102136063 (CDKN1A)
   04115 p53 signaling pathway
    102136063 (CDKN1A)
   04218 Cellular senescence
    102136063 (CDKN1A)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    102136063 (CDKN1A)
   04928 Parathyroid hormone synthesis, secretion and action
    102136063 (CDKN1A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102136063 (CDKN1A)
   05202 Transcriptional misregulation in cancer
    102136063 (CDKN1A)
   05206 MicroRNAs in cancer
    102136063 (CDKN1A)
   05205 Proteoglycans in cancer
    102136063 (CDKN1A)
   05203 Viral carcinogenesis
    102136063 (CDKN1A)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102136063 (CDKN1A)
   05212 Pancreatic cancer
    102136063 (CDKN1A)
   05225 Hepatocellular carcinoma
    102136063 (CDKN1A)
   05226 Gastric cancer
    102136063 (CDKN1A)
   05214 Glioma
    102136063 (CDKN1A)
   05216 Thyroid cancer
    102136063 (CDKN1A)
   05220 Chronic myeloid leukemia
    102136063 (CDKN1A)
   05217 Basal cell carcinoma
    102136063 (CDKN1A)
   05218 Melanoma
    102136063 (CDKN1A)
   05211 Renal cell carcinoma
    102136063 (CDKN1A)
   05219 Bladder cancer
    102136063 (CDKN1A)
   05215 Prostate cancer
    102136063 (CDKN1A)
   05213 Endometrial cancer
    102136063 (CDKN1A)
   05224 Breast cancer
    102136063 (CDKN1A)
   05222 Small cell lung cancer
    102136063 (CDKN1A)
   05223 Non-small cell lung cancer
    102136063 (CDKN1A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102136063 (CDKN1A)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102136063 (CDKN1A)
   05161 Hepatitis B
    102136063 (CDKN1A)
   05160 Hepatitis C
    102136063 (CDKN1A)
   05163 Human cytomegalovirus infection
    102136063 (CDKN1A)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102136063 (CDKN1A)
   05169 Epstein-Barr virus infection
    102136063 (CDKN1A)
   05165 Human papillomavirus infection
    102136063 (CDKN1A)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102136063 (CDKN1A)
   01522 Endocrine resistance
    102136063 (CDKN1A)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 102136063
NCBI-ProteinID: XP_015304968
UniProt: G7P3C1 A0A2K5TUL2
LinkDB
Position
4
AA seq 164 aa
MSEQAGSVRPNPCGSKACRRLFGPVDSEQLSRDCDALMAGCIQEARERWNFDFVTETPLE
GDFAWERVRGLGLPKLYLPTGPRRGRDELGGGRRPGTSPALLQGTAEEDHVDLSLSCTLV
PRSGEQPEESPGGPGDSQGRKRRQTSMTDFYHSKRRLIFSKRKP
NT seq 495 nt   +upstreamnt  +downstreamnt
atgtcagaacaggctggcagtgtccgtccgaacccatgcggcagcaaggcctgccgccgc
ctcttcggcccagtggacagcgagcagctgagccgcgactgtgatgcgctaatggcgggc
tgtatccaggaggcccgtgagcgatggaacttcgactttgtcaccgagacaccactggag
ggtgacttcgcctgggagcgtgtgcggggccttggcctgcccaagctctaccttcccaca
gggccccggcggggccgggatgagttgggaggaggcaggcggcctggcacctcacctgct
ctgctgcagggcacagcagaggaagaccatgtggacctgtcgctatcttgtacccttgtg
cctcgctcaggggagcagcctgaagagtccccaggtggacctggagactctcagggtcga
aaacggcggcagaccagcatgacagatttctaccactccaaacgccggctgatcttctcc
aagaggaagccctaa

DBGET integrated database retrieval system