KEGG   Macaca fascicularis (crab-eating macaque): 102136326
Entry
102136326         CDS       T02918                                 

Gene name
KITLG
Definition
(RefSeq) KIT ligand
  KO
K05461  KIT ligand
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04010  MAPK signaling pathway
mcf04014  Ras signaling pathway
mcf04015  Rap1 signaling pathway
mcf04072  Phospholipase D signaling pathway
mcf04151  PI3K-Akt signaling pathway
mcf04640  Hematopoietic cell lineage
mcf04916  Melanogenesis
mcf05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102136326 (KITLG)
   04014 Ras signaling pathway
    102136326 (KITLG)
   04015 Rap1 signaling pathway
    102136326 (KITLG)
   04072 Phospholipase D signaling pathway
    102136326 (KITLG)
   04151 PI3K-Akt signaling pathway
    102136326 (KITLG)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102136326 (KITLG)
  09152 Endocrine system
   04916 Melanogenesis
    102136326 (KITLG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102136326 (KITLG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcf04052]
    102136326 (KITLG)
Cytokines and growth factors [BR:mcf04052]
 Growth factors
  Growth factors (RTK binding)
   102136326 (KITLG)
SSDB
Motif
Pfam: SCF Psg1
Other DBs
NCBI-GeneID: 102136326
NCBI-ProteinID: XP_005571886
UniProt: A0A2K5VQ09
LinkDB
Position
11
AA seq 273 aa
MKKTQTWILTCIYLQLLLFNPLVKTEGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPG
MDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSS
KDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFAVASETSDCVVSSTLSPEKDSRVSVT
KPFMLPPVAASSLRNDSSSSNRKAKNPTGDSSLHWAAMALPAFFSLIIGFAFGALYWKKR
QPSLTRAVENIQINEDDNEISMLQEKEREFQEV
NT seq 822 nt   +upstreamnt  +downstreamnt
atgaagaagacacaaacttggattctcacttgcatttatctccaactgctcctatttaat
cctctcgtcaaaactgaagggatctgcaggaatcgtgtgactaataatgtaaaagacgtc
actaaattggtggcaaatcttccgaaagactatatgataaccctcaaatatgtccccggg
atggatgttttgccaagtcattgttggataagcgagatggtagtacaattgtcagacagc
ttgactgatcttctggacaagttttcaaatatttctgaaggcttgagtaattattccatc
atagacaaacttgtcaatatagtggatgaccttgtggagtgcgtgaaagaaaactcatct
aaggatctaaaaaaatcattcaagagcccagaacccaggctctttactcctgaagaattc
tttagaatttttaatagatccattgatgccttcaaggactttgcggtggcatctgaaact
agtgattgtgtggtttcttcgacattaagtcctgagaaagattccagagtcagtgtcaca
aaaccatttatgttaccccctgttgcagccagctcccttaggaatgacagcagtagcagt
aataggaaggccaaaaatcccactggagactccagcctacactgggcagccatggcattg
ccagcattcttttctcttataattggctttgcttttggagccttatactggaagaagaga
cagccaagtcttacaagggcagttgaaaatatacaaattaatgaagacgataatgagata
agtatgttgcaagagaaagagagagagtttcaagaagtgtaa

DBGET integrated database retrieval system