KEGG   Macaca fascicularis (crab-eating macaque): 102137898
Entry
102137898         CDS       T02918                                 

Gene name
CACNA1E
Definition
(RefSeq) calcium voltage-gated channel subunit alpha1 E
  KO
K04852  voltage-dependent calcium channel R type alpha-1E
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04010  MAPK signaling pathway
mcf04020  Calcium signaling pathway
mcf04930  Type II diabetes mellitus
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102137898 (CACNA1E)
   04020 Calcium signaling pathway
    102137898 (CACNA1E)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    102137898 (CACNA1E)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mcf04040]
    102137898 (CACNA1E)
Ion channels [BR:mcf04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   102137898 (CACNA1E)
SSDB
Motif
Pfam: Ion_trans Ca_chan_IQ GPHH PKD_channel
Other DBs
NCBI-GeneID: 102137898
NCBI-ProteinID: XP_015301997
LinkDB
Position
1
AA seq 2391 aa
MLPASPRGASGFDNFFPVQEGEGPGWEGAVALEAGSSPFLPVSPEVMKRRRGGLIEQRDI
IKAHEAHKMQSTPQARRKEWEMARFGEAVVARPGSGDGDSDQSRNRQGTPVPASGQAAAY
KQTKAQRARTMALYNPIPVRQNCFTVNRSLFIFGEDNIVRKYAKKLIDWPPFEYMILATI
IANCIVLALEQHLPEDDKTPMSRRLEKTEPYFIGIFCFEAGIKIVALGFIFHKGSYLRNG
WNVMDFIVVLSGILATAGTHFNTHVDLRTLRAVRVLRPLKLVSGIPSLQIVLKSIMKAMV
PLLQIGLLLFFAILMFAIIGLEFYSGKLHRACFMNNSGILEGFDPPHPCGVQGCPAGYEC
KDWIGPNDGITQFDNILFAVLTVFQCITMEGWTTVLYNTNDALGATWNWLYFIPLIIIGS
FFVLNLVLGVLSGEFAKERERVENRRAFMKLRRQQQIERELNGYRAWIDKAEEVMLAEEN
KNAGTSALEVLRRATIKRSRTEAMTRDSSDEHCVDISSVGTPLARASIKSAKVDGVSYFR
HKERLLRISIRHMVKSQVFYWIVLSLVALNTACVAIVHHNQPQWLTHLLYYAEFLFLGLF
LLEMSLKMYGMGPRLYFHSSFNCFDFGVTVGSIFEVVWAIFRPGTSFGISVLRALRLLRI
FKITKYWASLRNLVVSLMSSMKSIISLLFLLFLFIVVFALLGMQLFGGRFNFNDGTPSAN
FDTFPAAIMTVFQILTGEDWNEVMYNGIRSQGGVSSGMWSAIYFIVLTLFGNYTLLNVFL
AIAVDNLANAQELTKDEQEEEEAFNQKHALQKAKEVSPMSAPNMPSIERDRRRRHHMSMW
EPRSSHLRERRRRHHMSVWEQRTSQLRKHMQMSSQEALNREEAPSMNPLNPLSSLNPLNT
HSSLYRRPRAIEGLALGLALEKFEEERISRGGSLKGDGGDRSSALDNQRTPLSLGQREPP
WLARPCHGNCDPTQQETGGGEAVVTFEDRARHRQSQRRSRHRRVRTEGKESSSASRSRSA
SQERSLDEAMPTEGEKDPELRGNHGAKEPTIQEERAQDLRRTNSLMVSRGSGLAGGLDEA
NAPLVLPHPELEVGKDMVPTEQEPEGSSEQALLGDVQLDMGRVISQSEPDLSCITANTDK
ATTESTSVTVAIPDVGPLVDSTVVHISNKTDGEASPLKEAEIREDDEEVENKKQKKEKRE
TGKAMVPHSSMFIFSTTNPIRRACHYIVNLRYFEMCILLVIAASSIALAAEDPVLTNSER
NKVLRYFDYVFTGVFTFEMVIKMIDQGLILQDGSYFRDLWNILDFVVVVGALVAFALANA
LGTNKGRDIKTIKSLRVLRVLRPLKTIKRLPKLKAVFDCVVTSLKNVFNILIVYKLFMFI
FAVIAVQLFKGKFFYCTDSSKDTEKECIGNYVDHEKNKMEVKGREWKRHEFHYDNIIWAL
LTLFTVSTGEGWPQVLQHSVDVTEEDRGPSRSNRMEMSIFYVVYFVVFPFFFVNIFVALI
IITFQEQGDKMMEECSLEKNERACIDFAISAKPLTRYMPQNRHTFQYRVWHFVVSPSFEY
TIMAMIALNTVVLMMKYYSAPCTYELALKYLNIAFTMVFSLECVLKVIAFGFLNYFRDTW
NIFDFITVIGSITEIILTDSKLVNTSGFNMSFLKLFRAARLIKLLRQGYTIRILLWTFVQ
SFKALPYVCLLIAMLFFIYAIIGMQVFGNIKLDEESHINRHNNFRSFFGSLMLLFRSATG
EAWQEIMLSCLGEKGCEPDTTAPSGQNENERCGTDLAYVYFVSFIFFCSFLMLNLFVAVI
MDNFEYLTRDSSILGPHHLDEFVRVWAEYDRAACGRIHYTEMYEMLTLMSPPLGLGKRCP
SKVAYKRLVLMNMPVAEDMTVHFTSTLMALIRTALDIKIAKGGADRQQLDSELQKETLAI
WPHLSQKMLDLLVPMPKASDLTVGKIYAAMMIMDYYKQSKVKKQRQQLEEQKNAPIFQRM
EPSSLPQEIIANAKALPYLQQDPVSGLSGRSGYPSMSPLSPQEIFQLACMDPADDGQFQE
QQSLEPEVSELKSVQPSNHGIYLPSDTQEHAGSGRASSMPRLTVDPQVVTDPSSMRRSFS
TIRDKRSNSSWLEEFSMERSSENTYKSRRRSYHSSLRLSAHRLNSDSGHKSDTHRSGGRE
RGRSKERKHLLSPDVSRCNSEERGTQADWESPERRQSRSPSEGRSQTPNRQGTGSLSESS
IPSVSDTSTPRRSRRQLPPVPPKPRPLLSYSSLIRHVGSISPPADGSEEGSPLTSQALEN
NNTCLTESSNSPHPRQGQHASPQRYISEPYLALHEDSHASDCGEEETLTFEAAVATSLGR
SNTIGSAPPLRHSWQMPNGHYRRRRRGGPGPGMMCGAVNNLLSDTEEDDKC
NT seq 7176 nt   +upstreamnt  +downstreamnt
atgctgccggcctccccgcgcggcgcctctggcttcgacaacttcttcccggtgcaggag
ggcgagggcccgggctgggagggcgccgtggcactggaggcgggctccagccctttcctc
ccggtgagccccgaggtcatgaagcggcggcgtgggggcctcatcgagcagcgcgacatc
atcaaggcccacgaggcgcacaagatgcagagcaccccgcaggcccggcgcaaggaatgg
gagatggctcgcttcggggaggcggtggtcgccaggccggggtccggcgatggagactcg
gaccagagcaggaaccggcaaggaacccccgtgccggcctcggggcaggcggccgcctac
aagcagacgaaagcgcagagggcgcggactatggctttgtacaaccccattcccgtccgg
cagaactgtttcaccgtcaacagatccctgttcatcttcggagaagataacattgtcagg
aaatatgccaagaagctcatcgattggccgccatttgagtacatgatcctggccaccatc
attgccaactgcatcgtcctggccctggagcagcatcttcctgaggacgacaagaccccc
atgtctcgaagactggaaaagacagaaccttatttcattggaatcttttgctttgaagct
gggatcaaaattgtggccctggggttcatcttccataagggttcatacctccgcaatggc
tggaatgtcatggacttcatcgtggtcctcagtggcatcctggccactgcgggaacccac
ttcaacactcacgtggacctgaggaccctccgggctgtgcgtgtcctgcggcccttgaag
ctcgtgtcggggatacctagcctgcagattgtgttgaagtccatcatgaaggccatggta
cctcttctgcagattggccttctgctcttctttgccatcctgatgtttgctattattggc
ttggagttctacagtgggaagttacatcgagcatgcttcatgaacaattcaggtattcta
gaaggatttgacccccctcacccgtgtggcgtgcagggctgcccagctggttatgaatgc
aaggactggatcggccccaatgatgggatcacccagtttgataacatcctttttgctgtg
ctgactgtcttccagtgcatcaccatggaagggtggaccaccgtgctgtacaataccaat
gatgccttaggagccacctggaattggctgtacttcatccccctcatcatcattggatcc
ttctttgttctcaacctagtcctgggagtgctttccggggaatttgccaaagagagagag
agagtggagaaccgaagggctttcatgaaactgcggcgccagcagcagattgagcgtgag
ctgaatggctaccgtgcctggatagacaaagcagaggaagtcatgctcgctgaagaaaat
aaaaatgctggaacatctgccttagaagtgcttcgaagggcaaccatcaagaggagccgg
acagaggccatgacccgagactccagcgatgagcactgtgttgatatctcctctgtgggc
acacctctggcccgagccagtatcaaaagtgcaaaggtagatggggtctcttatttccgg
cacaaggaaaggcttctgcgcatctccattcgccacatggttaaatcccaggtgttttac
tggattgtgctgagccttgtagcactcaacactgcctgtgtggccattgtccatcacaac
cagccccagtggctcacccacctcctctactatgcagaatttctgtttctgggactcttc
ctcttggagatgtccctgaagatgtatggcatggggcctcgcctttattttcactcttca
ttcaactgctttgattttggggtcacagtgggcagtatctttgaagtggtctgggcaatc
ttcagacctggtacgtcttttggaatcagtgtcttgcgagccctccggcttctaagaata
tttaaaataaccaagtattgggcttccctgcggaatttggtggtctccttgatgagctca
atgaagtctatcatcagtttacttttcctcctcttcctcttcattgttgtctttgctctc
ctaggaatgcagttatttggtggcagatttaactttaatgatgggactccttcggcaaat
tttgacaccttccctgcagccatcatgaccgtgttccagatcctgacgggtgaggactgg
aatgaggtgatgtacaatgggatccgctcccagggcggggtcagctcaggcatgtggtct
gccatctacttcattgtgcttaccttgtttggcaactacacgctactgaatgtgttcttg
gctattgctgtagataatctagccaacgcccaggagctgaccaaggatgaacaggaggag
gaagaggccttcaaccagaaacatgcactgcagaaggccaaggaggtcagcccgatgtct
gcacccaacatgccttcgatcgaaagagacagaaggagaagacaccacatgtcgatgtgg
gagccacgcagcagccacctgagggagcggaggcgccggcaccacatgtctgtgtgggag
cagcgcaccagccagctgaggaagcacatgcagatgtccagccaggaggccctcaacagg
gaggaggcgccgtccatgaacccgctcaacccactcagctccctcaacccactcaacacc
cactccagcctttatcggagacccagggccatcgagggcctggccctgggcctggccctg
gagaagttcgaggaggagcgcatcagccgtggggggtccctcaagggggatggaggtgac
cgatccagtgccctggacaaccagaggacccccttgtccctgggccagcgggagccgccg
tggctggccaggccctgtcatgggaactgtgacccgactcagcaggagacggggggagga
gaggctgtggtgacctttgaggaccgggccaggcacaggcagagccagcggcgcagccgg
catcgccgcgtcaggacggaaggcaaggagtcctcctcagcctctcggagcaggtctgct
agccaggaacgcagtctggatgaagccatgcccactgaaggggagaaggaccctgagctc
aggggcaaccatggtgccaaggagccaacgatccaagaagagagagcccaggatttaagg
aggaccaacagtctgatggtgtccagaggctccgggctggcaggaggccttgatgaggct
aatgcccccttagtcctgccccatcctgagctggaagtggggaaggacatggtgccgacg
gagcaggagccggaaggtagcagtgagcaggccctgctgggggatgtgcagctagacatg
ggccgggtcatcagccagagtgagcccgacctctcctgcatcacggccaacacggacaag
gccaccaccgagagcaccagcgtcaccgtcgccatccccgacgtgggccccttggtggac
tcaactgtggtgcacattagcaacaagacggatggggaagccagtcccttgaaggaggca
gagatcagagaggatgatgaggaggtggagaataaaaagcagaagaaggagaagcgtgag
acaggcaaagccatggtgcctcacagctcaatgttcatcttcagcaccaccaacccgatc
cggagggcctgccactacatcgtgaacctgcgctactttgagatgtgcatcctcctggtg
attgcagccagcagcatcgccctggcggcagaggaccccgtcctgaccaactcagagcgc
aacaaagtcctgaggtattttgactatgtgttcacgggcgtgttcacctttgagatggtt
ataaagatgatagaccaaggcttgatcctgcaggatgggtcctacttccgagacctgtgg
aacatcctggactttgtggtggtcgttggcgcattggtggcctttgctctggcgaacgct
ttgggaaccaacaaaggacgggacatcaagaccatcaagtctctgcgggtgctccgagtt
ctaaggccactgaaaaccatcaagcgcttgcccaagctcaaggctgttttcgactgcgtg
gtgacctccttgaagaatgtcttcaacatacttattgtctacaagctcttcatgttcatc
tttgctgtcatcgcagttcagctcttcaagggaaagttcttttattgcacggacagttcc
aaggacacagagaaggagtgcataggcaactatgtagatcatgagaaaaacaagatggag
gtgaagggccgggaatggaagcgccatgaattccactacgacaacattatctgggccctg
ctgaccctcttcaccgtctccacgggggaaggatggcctcaagttctgcagcactctgta
gatgtgacagaggaagaccgaggcccaagccgcagcaaccgcatggagatgtctatcttt
tatgtggtctactttgtggtcttccctttcttctttgtcaatatctttgtggctctcatc
atcatcaccttccaggagcaaggggataagatgatggaggagtgcagcctggagaagaat
gagagggcgtgcatcgacttcgccatcagcgccaaacctctcacccgctacatgccgcag
aacaggcacaccttccagtaccgcgtgtggcactttgtggtgtctccgtccttcgaatac
accattatggccatgatcgccttgaataccgtcgtgctgatgatgaagtattactctgct
ccctgtacctatgagctggccctgaagtatctgaatatcgccttcaccatggtgttttcc
ctggaatgcgtcctgaaggtcatcgcttttggctttttgaactatttccgagacacctgg
aatatctttgacttcatcaccgtgattggcagtataacagaaattatcctgacagacagc
aagctggtgaacaccagtggcttcaatatgagctttctgaagctcttccgagctgcccgc
ctcataaagcttctgcgtcagggctataccatacgcattttgctgtggacctttgtgcag
tcctttaaggccctcccttacgtctgccttttaattgccatgcttttcttcatttatgcc
atcattgggatgcaggtatttggaaacataaaattagatgaggagagtcacatcaaccgg
cacaacaacttccggagtttctttgggtccctaatgctactcttcaggagtgccacaggt
gaggcctggcaggagattatgctgtcatgcctcggggagaagggctgtgagcctgacacc
accgcaccgtcagggcagaacgagaacgagcgctgcggcaccgatctggcctacgtgtac
tttgtctccttcatcttcttctgctccttcttgatgctcaacctgttcgtggccgtcatc
atggacaactttgagtacctgactcgggactcctccatcctggggcctcaccacttggac
gagtttgtccgcgtctgggcagaatatgaccgagcagcatgtggccgcatccattacact
gagatgtatgaaatgctgactctcatgtcacctccgctaggcctcggcaagagatgtccc
tccaaagtggcatataagaggttggtcctgatgaacatgccagtagctgaggacatgacg
gtccacttcacctccacacttatggctttgatccggacagctctggacattaaaattgcc
aaaggtggtgcagacaggcagcagctagactcagagctacaaaaggagaccctagccatc
tggcctcacctatcccagaagatgctggatctgcttgtgcccatgcccaaagcctctgac
ctgactgtgggcaaaatctatgcagcaatgatgatcatggactactataagcagagtaag
gtgaagaagcagaggcagcagctggaggaacagaaaaatgcccccatattccaacgcatg
gagccctcatctctgcctcaggagatcatcgctaatgccaaagccctgccttacctccag
caggaccccgtttcaggcctgagtggccggagtggatacccttcgatgagtccactctct
ccccaggagatattccagttggcttgtatggaccccgccgatgatggacagttccaggaa
cagcagtctctggagccagaggttagtgaattaaaaagcgtgcagccctctaaccatggc
atctaccttccttcggacacccaggagcatgcgggatctgggagggcatcctctatgcca
cgtctgactgtggatccccaggtggtgacagaccctagctccatgagacgttcattttcc
actattcgggataagcgttcaaattcctcctggttggaggaattctccatggagcgaagc
agtgaaaatacctacaagtcccgtcgccggagttaccactcctccttgcggctgtcagcc
caccgcctgaactctgattcaggccacaagtctgacactcaccgctcagggggcagggag
cgaggacgatcaaaagagcgaaagcatcttctctctcctgatgtctcccgctgcaattca
gaagagcgagggacccaggctgactgggagtccccagagcgccgtcaatccaggtcaccc
agtgagggcaggtcacagacgcccaacagacagggcacaggttccctaagtgagagctcc
atcccctctgtctctgacaccagcaccccaagaagaagtcgtcggcagctcccgcccgtc
ccaccaaagccccggcccctcctttcctacagctccctgattcgacacgtgggcagcatc
tctccacctgctgacggaagcgaggagggctccccactgacctcccaagcgctggagaac
aacaacacttgcctgaccgagtcttccaactccccgcacccccggcagggccaacatgcc
tccccacagcgctacatctccgagccctacttggccctgcacgaagactcccacgcctca
gactgtggcgaggaggagacgctcacttttgaagcagccgtggctactagcctgggccgt
tccaacaccatcggctcagccccacccctgcggcacagctggcagatgcccaatgggcac
tatcggcgacggaggcgcggggggcctgggccaggcatgatgtgtggggctgtcaacaac
ctgctaagtgacacggaagaagacgacaaatgctag

DBGET integrated database retrieval system