KEGG   Macaca fascicularis (crab-eating macaque): 102138639
Entry
102138639         CDS       T02918                                 

Definition
(RefSeq) interleukin-3 receptor subunit alpha-like
  KO
K04737  interleukin 3 receptor alpha
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04060  Cytokine-cytokine receptor interaction
mcf04151  PI3K-Akt signaling pathway
mcf04210  Apoptosis
mcf04630  JAK-STAT signaling pathway
mcf04640  Hematopoietic cell lineage
mcf05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102138639
   04151 PI3K-Akt signaling pathway
    102138639
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102138639
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102138639
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102138639
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102138639
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mcf04050]
    102138639
   04090 CD molecules [BR:mcf04090]
    102138639
Cytokine receptors [BR:mcf04050]
 Interleukin receptor families
  IL3 receptor family
   102138639
CD molecules [BR:mcf04090]
 Proteins
  102138639
SSDB
Motif
Pfam: IL6Ra-bind CRAM_rpt
Other DBs
NCBI-GeneID: 102138639
NCBI-ProteinID: XP_015300253
LinkDB
Position
Un
AA seq 169 aa
CALGQVGLSPVQAFGARSSRNLTAYRSSHEQYRCLHYKTDARGTQIGCRFDDIARLSHGS
QSSHILVRGRSAAVSIPCTDKFVFFSQIERLTPPNMTGECNETHSFMHWKMKSHFNRKFR
YELRIQKVNRSPVPPTTPALDIPDFWEVALWGLGTGKKISDNATERRDR
NT seq 511 nt   +upstreamnt  +downstreamnt
gtgtgcccttgggcaggtcgggctgtccccggtgcaggccttcggggcacggtcgtcccg
caaccttaccgcttaccgcagcagccacgaacagtacaggtgccttcactacaaaacgga
tgctcggggaacacagatcgggtgtcggttcgatgacatcgctcgactttcccacggttc
tcaaagttcccacatcctggtgaggggcaggagcgcagccgtcagtatcccctgcacaga
taagtttgtcttcttttcacagattgagagattaactccacccaacatgactggagagtg
taatgagacacattccttcatgcactggaaaatgaaaagtcatttcaatcgcaaattccg
ctatgagcttcggatccaaaaggtaaaccgttcacccgttccccccaccacccccgccct
ggacatccctgatttttgggaagttgcactctggggccttgggacgggcaaaaaaatctc
tgataatgccacagaacgcagggatcgttaa

DBGET integrated database retrieval system