KEGG   Macaca fascicularis (crab-eating macaque): 102139620Help
Entry
102139620         CDS       T02918                                 

Gene name
CSAD
Definition
(RefSeq) cysteine sulfinic acid decarboxylase
  KO
K01594  sulfinoalanine decarboxylase [EC:4.1.1.29]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf00430  Taurine and hypotaurine metabolism
mcf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    102139620 (CSAD)
Enzymes [BR:mcf01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.29  sulfinoalanine decarboxylase
     102139620 (CSAD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Beta_elim_lyase SepSecS
Motif
Other DBs
NCBI-GeneID: 102139620
NCBI-ProteinID: XP_005571033
LinkDB All DBs
Position
11
AA seq 544 aa AA seqDB search
MGRPEKLALYRGGQTRVEENSRAIAGCFGGGQKRDWQCPHVRVLCVSPKILMADSEALPS
LAGDPVAVEALLRAVFGVVVDEAIQKGTSASQKVCEWKEPEELKQLLDLELRCQGESQEQ
ILERCRTVIRYSVKTGHPRFFNQLFSGLDPHALAGRIITESLNTSQYTYEIAPVFVLMEE
EVLRKLRALVGWSSGDGIFCPGGSISNMYAVNLARYQRYPDCKQRGLRTLPPLALFTSKE
CHYSIQKGAAFLGLGTDSVRVVKADERGKMVPEDLERQIGMAEAEGAVPFLVSATSGTTV
LGAFDPLEAIADVCQRHGLWLHVDAAWGGSVLLSQTHRHLLDGIQRADSVAWNPHKLLAA
GLQCSALLLQDTSNLLKRCHGSQASYLFQQDKFYDVALDTGDKVVQCGRRVDCLKLWLMW
KAQGDQGLERRIDQAFALARYLVEEIKKREGLELVMEPEFVNVCFWFVPPSLRGKQDSPD
YHERLSKVAPVLKERMVKEGSMMIGYQPHGTRGNFFRVVVANPALTCADMDFLLNELERL
GQDL
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atgggccggcccgaaaagctcgcactttacagaggcggacagactagggtggaggaaaac
tcaagggccattgctgggtgcttcggtggcgggcagaaacgggactggcagtgcccacac
gtgcgcgttctctgcgtcagcccgaagatcctgatggctgactcagaagcactcccctcc
cttgctggggacccagtggctgtggaagccttgctccgggccgtgtttggggttgttgtg
gatgaggccattcagaaaggaaccagtgcctcccagaaggtctgtgagtggaaggagcct
gaggagctgaagcagctgctggatttggagctgcggtgccagggcgagtcgcaggagcag
atcctggagcggtgtcggactgtgattcgctacagtgtcaagactggtcaccctcggttc
ttcaaccagctcttctcagggttggatccccatgctctggccgggcgcattatcactgag
agcctcaacaccagccagtacacatatgaaatcgcccccgtgtttgtgctcatggaagag
gaggtgctgaggaaactgcgggccctggtgggctggagctctggggatggaatcttctgc
cctggtggctccatctccaacatgtatgctgtaaatctggcccgctatcagcgctacccg
gattgcaagcagaggggcctccgcacactgccgcccctggcactattcacatcgaaggag
tgtcactactccatccagaagggagctgcgtttctgggacttggcaccgacagtgtccga
gtagtcaaggctgatgagagagggaaaatggtccccgaggatctggagaggcagattggt
atggctgaggctgagggtgctgtgccgttcctggtcagtgccacctctggcaccactgtg
ctaggggcctttgaccccctggaggcaattgctgatgtgtgccagcgtcatgggctctgg
ctgcatgtggatgctgcctggggtgggagcgtcctgctgtcacagacacacaggcatctc
ctggatgggatccagagggctgactctgtggcctggaatccccacaagctcctcgccgca
ggcctgcaatgctctgcacttcttctccaggatacctcgaacctgctcaagcgctgccat
gggtcccaggccagctaccttttccagcaggacaagttctacgatgtggctctggacacg
ggagacaaggtagtgcagtgtggccgccgtgtggactgtctgaagctgtggctcatgtgg
aaggcacagggcgatcaagggctggaacggcgcatcgaccaggcctttgcccttgcccgg
tacctggtagaggaaataaagaagcgggaagggttggagctagtcatggagcctgagttt
gtcaatgtgtgtttctggttcgtaccccccagcctgcgagggaagcaggacagtccagat
taccacgagaggctgtccaaggtggcccccgtgctcaaggagcgcatggtgaaggagggc
tccatgatgattggctaccagccccacggaacccggggtaacttcttccgtgtggttgtg
gccaaccctgcgctgacctgtgctgatatggacttcctcctcaacgagctggagcgacta
ggccaggacctgtga

DBGET integrated database retrieval system