KEGG   Macaca fascicularis (crab-eating macaque): 102140882Help
Entry
102140882         CDS       T02918                                 

Gene name
HDAC2
Definition
(RefSeq) histone deacetylase 2
  KO
K06067  histone deacetylase 1/2 [EC:3.5.1.98]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04110  Cell cycle
mcf04213  Longevity regulating pathway - multiple species
mcf04330  Notch signaling pathway
mcf04919  Thyroid hormone signaling pathway
mcf05016  Huntington disease
mcf05034  Alcoholism
mcf05165  Human papillomavirus infection
mcf05169  Epstein-Barr virus infection
mcf05200  Pathways in cancer
mcf05202  Transcriptional misregulation in cancer
mcf05203  Viral carcinogenesis
mcf05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    102140882 (HDAC2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102140882 (HDAC2)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    102140882 (HDAC2)
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    102140882 (HDAC2)
 09160 Human Diseases
  09161 Cancers
   05200 Pathways in cancer
    102140882 (HDAC2)
   05202 Transcriptional misregulation in cancers
    102140882 (HDAC2)
   05203 Viral carcinogenesis
    102140882 (HDAC2)
   05220 Chronic myeloid leukemia
    102140882 (HDAC2)
  09163 Neurodegenerative diseases
   05016 Huntington disease
    102140882 (HDAC2)
  09164 Substance dependence
   05034 Alcoholism
    102140882 (HDAC2)
  09167 Infectious diseases
   05169 Epstein-Barr virus infection
    102140882 (HDAC2)
   05165 Human papillomavirus infection
    102140882 (HDAC2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mcf03036]
    102140882 (HDAC2)
Enzymes [BR:mcf01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     102140882 (HDAC2)
Chromosome and associated proteins [BR:mcf03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     102140882 (HDAC2)
   HDAC complexes
    Sin3A-HDAC complex
     102140882 (HDAC2)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    102140882 (HDAC2)
  Chromatin remodeling factors
   NuRD complex
    102140882 (HDAC2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 102140882
NCBI-ProteinID: XP_005551686
UniProt: A0A2K5TJ71
LinkDB All DBs
Position
4
AA seq 488 aa AA seqDB search
MAYSQGGGKKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKA
TAEEMTKYHSDEYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVA
GAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHH
GDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNFPMRDGIDDESYGQ
IFKPIISKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTVKGHAKCVEVVKTFNLPLLMLG
GGGYTIRNVARCWTYETAVALDCEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYM
EKIKQRLFENLRMLPHAPGVQMQAIPEDAVHEDSGDEDGEDPDKRISIRASDKRIACDEE
FSDSEDEGEGGRRNVADHKKGAKKARIEEDKKETEDKKADVKEEDKSKDNSGEKTDTKGT
KSEQLSNP
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atggcgtacagtcaaggaggcggcaaaaaaaaagtctgctactactacgacggtgatatt
ggaaattattattatggacagggtcatcccatgaagcctcatagaatccgcatgacccat
aacttgttgttaaattatggcttatacagaaaaatggaaatatataggccccataaagcc
actgctgaagaaatgacaaaatatcacagtgatgagtatatcaaatttctgcggtcaata
agaccagataatatgtctgagtatagtaagcagatgcagagatttaatgttggagaagat
tgtccagtgtttgatggactctttgagttttgtcaactctcaactggtggttcagttgct
ggagccgtgaagttaaaccgacaacagactgatatggctgttaattgggctggaggatta
catcatgctaagaaatcagaagcatcaggattctgttatgttaatgatattgtgcttgcc
atccttgaattactaaagtatcatcagagagtcttatatattgatatagatattcatcat
ggtgatggtgttgaagaagctttttatacaacagatcgtgtaatgacggtatcattccat
aaatatggggaatactttcctggcacaggagacttgagggatattggtgctggaaaaggc
aaatactatgctgtcaattttccaatgagagatggtatagatgatgagtcatatgggcag
atatttaagcctattatctcaaaggtgatggagatgtatcaacctagtgctgtggtatta
cagtgtggtgcagactcattatctggtgatagactgggttgtttcaatctaacagtgaaa
ggtcatgctaaatgtgtagaagttgtaaaaacttttaacttaccattactgatgcttggt
ggaggtggatacacaatccgtaatgttgctcgatgttggacatatgagactgcagttgcc
cttgattgtgagattcccaatgagttgccgtataatgattactttgagtattttggacca
gacttcaaactgcatattagtccttcaaacatgacaaaccagaacactccagaatatatg
gaaaagataaaacagcgtttatttgaaaatttgcgcatgttacctcatgcacctggtgtc
cagatgcaagctattccagaagatgctgttcatgaagacagtggagatgaagatggagaa
gatccagacaagagaatttctattcgagcatcagacaagcggatagcttgtgatgaagaa
ttctcagattctgaggatgaaggagaaggaggtcgaagaaatgtggctgatcataagaaa
ggagcaaagaaagctagaattgaagaagataagaaagaaacagaggacaaaaaagcagac
gttaaggaagaagataaatccaaggacaacagtggtgaaaaaacagataccaaaggaacc
aaatcagaacagctcagcaacccctga

DBGET integrated database retrieval system