KEGG   Macaca fascicularis (crab-eating macaque): 102141036Help
Entry
102141036         CDS       T02918                                 

Gene name
LCT
Definition
(RefSeq) lactase
  KO
K01229  lactase-phlorizin hydrolase [EC:3.2.1.108 3.2.1.62]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf00052  Galactose metabolism
mcf01100  Metabolic pathways
mcf04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:mcf00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    102141036 (LCT)
 Organismal Systems
  Digestive system
   04973 Carbohydrate digestion and absorption
    102141036 (LCT)
Enzymes [BR:mcf01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.62  glycosylceramidase
     102141036 (LCT)
    3.2.1.108  lactase
     102141036 (LCT)
Chaperones and folding catalysts [BR:mcf03110]
 Intramolecular chaperones
  Others
   102141036 (LCT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_1
Motif
Other DBs
NCBI-GeneID: 102141036
NCBI-ProteinID: XP_005573098
UniProt: A0A2K5VET3
LinkDB All DBs
Position
12
AA seq 1928 aa AA seqDB search
MELSWHVAFIALLSVSCWGSDWESERNFISTAGPLTNDLLHNLSGPLGDQSSNFVAGDKD
MYVCHQPLPTFLPEYFSSLHASQITHYKVFLSWAQLLPAGSTQNPDKKTVQCYRRLLEAL
KTARLQPMVILHHQTLPASTLQRTEVFADLFADYATFAFHSFGDLVGIWFTFSDLEEVIK
ELPHQESRASRLQTLSDAHRKAYEIYHENYASQGGKLSVVLRVEDIPELLLEPPISALAQ
DTVDFLSLDLSYECQNEASLRQKLSKLQTIEPKVKVFVFNLKLLDCPSTVKSPARLLFSL
LEAINKDQVLTIGFDINEFLSCSSSSKKSMSCSLTGSLALQPEEQQDHEISGSSPASAYQ
RVWEAFANQSRAERDAFLQDTFPEGFLWGASTGAFNVEGGWAEGGRGASIWDPRRPLNTT
EGQATPEVASDSYHKVASDVALLRGLRAQVYKFSISWSRIFPTGHGSSPSLPGVAYYNKL
IDRLRDAGIQPMATLFHWDLPQALQDHGGWQNESVVDAFLDYAAFCFSTFGDRVKLWVTF
HEPWVISYAGYGTGQHPPGISDPGVASFKVAHLVLKAHARTWHYYNSHHRPQQQGHVGIV
LNSDWAEPLSPERPEDLRASERFLHFMLGWFAHPIFVDGDYPATLRTQIQQMNRQCLHPV
AQLPEFTEAEKQLLKGSADFLGLSHYTSRLISNAPQNTCIPSYDTIGGFSQHVNHAWPQT
SSSWIRVVPWGIRRLLQFVSLEYTRGKVPIYLAGNGMPIGESEDLFDDSLRVDYFNQYIN
EVLKAIREDSVDVRSYIARSLIDGFEGPSGYSQRFGLHHVNFNDSSKSRTPRKSAYFFTS
VIEKNGFLTKGAKRLPPPNTANLPSKARAFAFPSEVPSKAKVVWEKFSSQPKFERDLFYH
GTFRDDFLWGVSSSAYQIEGGWDADGKGPSIWDNFTHTPGSNVKDNATGDIACDSYHQLD
ADLNMLRALKVKAYRFSISWSRIFPTGRNSSINSHGVDYYNRLIDGLMASNIFPMVTLFH
WDLPQALQDIGGWENPALIELFDSYADFCFQTFGDRVKFWMTFNEPMYLAWLGYGSGEFP
PGVKDPGWAPYRIAHAVIKAHARVYHTYDEKYRQQQKGVISLSLSTHWAEPKSPGVPRDV
EAADRMLQFSLGWFAHPIFRNGDYPDAMKWKVGNRSELQHLATSRLPSFTEEEKRFIRAT
ADVFCLNTYSSRIVQYKTPSLNPPSYEDDREMAEEEDTSWPSTALNRAAPWGMRRLLNWI
KEEYGDIPIYITENGVGLTNPNAEDTSRIFYHKTYINEALKAYRVDGVDLRGYVAWSLMD
NFEWLNGYTVKFGLYHVDFNNTNRPRTARTSARYYTEVITNNGMPLAREDEFLYGRFPEG
FIWSAASAAYQIEGAWRADGKGLSIWDTFSHTPLKVENDAVGDVACDSYHKIAEDLVTLQ
NLGVSHYRFSISWSRILPDGTTRYINEAGLNYYVRFIDALLAASIQPQVTIYHWDLPQAL
QDVGGWENETIVQRFKEYADVLFQRLGNKVKFWITLNEPFVIAYQGYGYGTAAPGIFVRP
GTAPYIVGHNLIKAHAEAWHLYNDVYRASQGGVISITISSDWAEPRDPSNQEDVEAARRY
VQFMGGWFAHPIFKNGDYNEVMKTRIRDRSLAAGLNKSRLPEFTESEKRRINGTYDFFGF
NHYTTVLAYNLNYATAISSFDADRGVASIADRSWPDSGSFWLKMTPFGFRRILNWLKEEY
NDPPIYVTENGVSQREETDLNDTARIYYLRTYINEALKAVQDKVDLRGYTVWSAMDNFEW
ATGFSERFGLHFVNYSDPSLPRIPKASAKFYASVVRCNGFPDPATGPHACLNQPEDAGPT
VSPVREEKVPFLGLTLGTAEAQTALYVLFSLVLLGVCGLAFLSYKYCKRSKQGKTQPSQQ
ELSPVSSF
NT seq 5787 nt NT seq  +upstreamnt  +downstreamnt
atggagctgtcttggcatgtagcctttattgccctgctaagtgtttcatgctgggggtca
gactgggagtctgagagaaatttcatttccaccgctggtcctttaaccaatgacttgctg
cacaacctgagtgggcccctgggagaccagagttctaactttgtagcaggggacaaagac
atgtatgtttgtcaccagccactgcccactttcctgccagaatacttcagcagtcttcat
gccagtcagatcacccactacaaggtatttctgtcatgggcacagctcctcccagcagga
agcacccagaatccagacaagaaaacagtgcagtgctaccggcgactgctggaggccctc
aagactgcacggcttcagcccatggtcatcctgcaccaccagaccctcccggccagcacc
ctccagagaaccgaagtcttcgctgacctctttgccgactatgccacattcgccttccac
tccttcggggacctagttgggatctggttcaccttcagtgacttggaggaagtgatcaag
gagcttccccaccaggaatcaagagcgtcacgactccagaccctcagtgatgcccacaga
aaagcctatgagatttaccatgaaaactatgcttctcagggcggaaaactctctgttgtc
ctgcgagttgaagatatcccggagctcctgctagaaccacccatatctgcgcttgcccag
gacacggttgatttcctctctcttgatttgtcttacgaatgccaaaatgaggcaagtctg
cggcagaagctgagtaaattgcagaccattgagccaaaagtgaaagttttcgtcttcaac
ctaaaactcctggactgcccctccaccgtgaagagcccagccaggctgctcttcagcctt
ttggaagccataaataaagaccaagtgctcaccattgggtttgatattaatgagtttctg
agttgttcatcaagttccaagaaaagcatgtcttgttctctgactggcagcctggccctt
cagcctgaagagcagcaggaccacgagatctcgggctcctctcctgcctcggcctatcag
agagtctgggaagcatttgccaatcagtccagggcggaaagggacgccttcctgcaggac
acttttcccgaaggctttctctggggtgcctccacgggagcctttaacgtggaaggaggc
tgggccgagggcgggagaggggcgagcatctgggatccacgcaggcccctgaacaccacg
gagggtcaagcgacgccggaggtggccagcgacagctaccacaaggtggcctctgacgtc
gccctgcttcgcggcctccgggctcaggtgtacaagttctccatttcctggtcccggatc
ttccccacggggcacgggagcagccccagcctcccaggcgtcgcctactacaacaagctg
attgacaggctgcgggacgcgggcatccagcccatggccacgctgttccactgggacctg
cctcaggccctgcaggatcatggcggatggcagaatgagagcgtggtggatgccttcctg
gactacgcggccttctgcttctccacatttggggaccgtgtgaagctgtgggtgaccttc
catgagccgtgggtgataagctacgcaggctatggcaccggccaacaccctcccggcatc
tctgacccaggagtggcctcttttaaggtggctcacttggtcctcaaggctcatgccaga
acctggcactactacaacagccaccatcgcccacagcagcaggggcatgtgggcattgtg
ctgaactcagactgggcagaacccctgtctccagagaggcctgaggacttgagagcctct
gagcgcttcttgcacttcatgctgggctggtttgcacaccccatctttgtggatggagac
tatccagccaccctgaggacccagatccaacagatgaacagacagtgcctccatcctgtg
gctcaactccccgagttcacagaggcagagaagcagctcctgaaaggctccgctgatttt
ctgggtctgtcacattacacctcccgcctcatcagcaacgccccacaaaacacctgcatc
cctagctatgataccattggaggcttctcccaacacgtgaaccatgcgtggccccagacc
tcatcctcttggattcgtgtggtgccctgggggataagaaggctgttgcagtttgtatcc
ctggaatacacacgaggaaaagttccaatatacctggccgggaatggcatgcctataggg
gaaagtgaagatctctttgatgattccttgagagtagactacttcaatcaatatatcaat
gaggtgctcaaggctatcagggaagactccgtggatgttcgttcctacattgctcgctcc
ctcattgatggcttcgaaggcccctctggttacagccagaggtttggcctgcaccatgtc
aacttcaacgacagcagcaagtcaaggactcccaggaaatctgcctactttttcactagc
gtcatagaaaagaacggtttcctcaccaagggggcaaaaagactgccaccacctaataca
gcaaacctcccctccaaagccagagccttcgcttttccatctgaggtgccctccaaggct
aaagtcgtttgggaaaagttctccagccaacccaagtttgaaagagatttgttctaccac
gggaccttccgggatgactttctgtggggcgtgtcctcttccgcttatcagatcgaaggc
gggtgggatgccgacggcaaaggccccagcatctgggataactttacccacacaccaggg
agcaatgtgaaagacaatgccactggagacatcgcctgtgacagctatcaccagctggat
gccgatctgaatatgctccgagctttgaaggtgaaggcctatcgcttctctatctcctgg
tctcggattttcccaactgggagaaacagctctatcaacagtcacggggttgattattac
aataggctgattgatggcttgatggcaagcaacatctttcctatggtgacattgttccat
tgggacctgccccaggccctccaggatatcggaggctgggagaatcctgccttgattgag
ttgtttgacagctacgcagacttttgtttccagacctttggtgacagagtcaagttctgg
atgacttttaatgagcccatgtacctggcatggctgggttacggctcaggggaatttccc
ccaggggtgaaggacccaggctgggcaccatataggatagcccacgccgtcatcaaagcc
catgccagagtctatcacacgtacgatgagaaatacaggcagcagcagaagggggtcatc
tcgctgagcctcagtacacactgggcagagcccaagtcaccaggggtccccagagatgtg
gaagccgctgaccgaatgctgcagttctccctgggctggtttgcccaccccatttttaga
aacggagactatcctgacgccatgaagtggaaagtggggaacaggagtgaactgcagcac
ttagccacctcccgcctgccaagcttcactgaggaagagaagaggttcatcagggcgacg
gccgacgtcttctgcctcaacacatactcctccagaatcgtgcagtacaaaacacccagt
ctaaacccaccctcctatgaagatgaccgggagatggctgaggaggaggacacttcgtgg
ccttccacagcactgaacagagctgcgccctgggggatgcgaaggctgctgaactggatc
aaggaagagtatggtgacattcccatttacatcaccgaaaatggagtgggactgaccaat
ccgaacgcagaggataccagtaggatattttaccacaaaacctatatcaatgaggctttg
aaagcctacagggtcgatggtgtagaccttcgagggtatgtcgcctggtctctgatggac
aactttgagtggctgaatggctacacggtcaagtttggactgtaccatgttgatttcaac
aacacgaacaggcctcgcacagcaagaacctctgccaggtactacacagaggtcattacc
aacaacggcatgccactggccagggaggatgagtttctgtacggacggtttcctgaaggc
ttcatctggagtgcggcttctgctgcatatcagatcgaaggtgcgtggagagcagatggc
aaaggactcagcatttgggacacattttctcacacaccgctgaaggttgaaaacgacgcc
gtcggagacgtggcctgtgacagttatcacaagattgctgaggatctggtcaccctgcag
aacctgggcgtgtcccactaccgtttttccatctcctggtctcgcatcctccctgatgga
accaccaggtacatcaatgaagcgggcctgaactactacgtgaggttcattgacgcactg
ctggccgccagcatccagcctcaggtgaccatttaccactgggacctaccgcaggcgctt
caggatgtgggaggctgggagaatgagaccatcgtgcagcggtttaaggagtatgcagat
gtgctcttccagaggctgggaaacaaggtgaagttttggatcacgctgaatgagcccttt
gtcattgcttaccagggatatggctatggaacagcggctccaggaatctttgttaggcct
ggcactgccccctacattgttggccacaacctaataaaggctcatgctgaggcctggcat
ctgtacaacgatgtataccgcgccagtcaaggtggtgtgatttccatcaccatcagcagt
gactgggctgaacccagagatccctctaaccaggaggatgtggaggcggccaggagatat
gttcagttcatgggaggctggtttgcgcatcctattttcaagaatggagattacaacgag
gtgatgaagacgcggatccgtgacaggagcttggctgcaggcctcaacaagtctcggctg
ccagaatttacagagagtgagaagaggaggatcaacggtacctatgacttttttgggttc
aatcactacaccactgtcctggcctacaacctcaactatgccactgccatctcttctttt
gatgcagacagaggagttgcctccatcgcagatcgctcatggccagactctggctccttc
tggctgaagatgacgccttttggcttcaggaggatcctgaactggttaaaggaggaatac
aatgaccctccgatttatgtcacggagaatggagtgtcccagcgggaagaaacagacctc
aatgacactgcaaggatctactaccttcggacttacatcaacgaggccctcaaagctgtg
caggacaaggtggaccttcgaggatacacagtttggagtgcgatggacaattttgagtgg
gccacaggcttttcagagagatttggtctgcattttgtgaactacagtgacccttcgctg
ccaaggatccccaaggcgtcagccaagttctatgcctctgtggtccgatgcaatggcttc
cctgaccccgctacagggcctcacgcttgtctcaaccagccagaagatgctggacccacc
gtcagccctgtgagagaggagaaggtgccgttcctggggctaacgctcggcactgcagaa
gcacagacagctttgtacgttctcttttctctggtgcttcttggagtctgtggcttggca
tttctctcatacaagtactgcaagcgttctaagcaagggaaaacacaaccaagccaacag
gaattgagcccagtgtcttcgttctga

DBGET integrated database retrieval system