KEGG   Macaca fascicularis (crab-eating macaque): 102141245Help
Entry
102141245         CDS       T02918                                 

Gene name
GAA
Definition
(RefSeq) glucosidase alpha, acid
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf00052  Galactose metabolism
mcf00500  Starch and sucrose metabolism
mcf01100  Metabolic pathways
mcf04142  Lysosome
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    102141245 (GAA)
   00500 Starch and sucrose metabolism
    102141245 (GAA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    102141245 (GAA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcf04147]
    102141245 (GAA)
Enzymes [BR:mcf01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     102141245 (GAA)
Exosome [BR:mcf04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102141245 (GAA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 102141245
NCBI-ProteinID: XP_005585247
UniProt: A0A2K5VE94
LinkDB All DBs
Position
16
AA seq 952 aa AA seqDB search
MGVRHPLCSRRLLAVCALVSLATAVLLGHILLHDFLLVPRELSGSSLVLEETRPARQQGA
SRPGPQNAQAHPGCPRAVPTQCDVPPNSRFDCAPDKAITQEQCEARGCCYIPAKQELRRA
QMGQPWCFFPPSYPSYKLENLSASEMGYTATLTRTTPTFFPKDILTLRLDVMMETENRLH
FTIKDPANKRYEVPLETPRVPSRALSPLYSVEFSEEPFGVIVRRQLDGRVLLNTTVAPLF
FADQFLQLSTSLPSQYITGLAEHLSPLMLSTSWTRITLWNRDLAPTPGANLYGSHPFYLA
LEDGGSAHGVFLLNSNAMDVVLQPSPALSWRSTGGILDVYIFLGPEPKSVVRQYLDVVGY
PFMPPYWGLGFHLCRWGYSSTAITRQVVENMTRAHFPLDVQWNDLDYMDSRRDFTFNKDG
FRDFPAMVQELHQGGRRYVMIVDPAISSSGPAGSYRPYDEGLRRAVFITNETGQPLIGKV
WPGSTAFPDFTNPAALAWWEDMVAEFHDQVPFDGMWIDMNEPSNFIRGSEDGCPHNELEE
PPYVPGVVGGTLQAATICASSHQFLSTHYNLHNLYGLTEAIASYRALVKARGTRPFVISR
STFAGHGRYAGHWTGDVWSSWEQLAASVPEILQFNLLGVPLVGADVCGFLGNTSEELCVR
WTQLGAFYPFMRNHNGLLNLPQEPYSFSEPAQQAMRKALTLRYALLPHLYTLFHQAHVAG
ETVARPLFLEFPEDSSTWTVDHQLLWGEALLITPVLQAGKAEVTGYFPSGTWYDLETVPI
EALGSLPPPPAAPREPAIHSEGQWVTLPAPLDTINVHLRAGHIIPLQGPGLTTTESRQQP
MALAVALTKGGEARGELFWDDGESLEVLERGAYTQVIFLARSNTVMNELVHVTSEGAGLQ
LQKVTVLGVATAPQQVLSNGAPVSNFTYSPDTKVLDIPVSLLVGEQFLISWS
NT seq 2859 nt NT seq  +upstreamnt  +downstreamnt
atgggagtgaggcacccgctctgctcccgccggctgctggccgtctgtgcccttgtgtcc
ttggccaccgctgtgctcctgggacacatcctgctccatgatttcctgctggttccccga
gagctgagtggatcctccttggtcctggaggagactcgcccagctcgccagcagggagcc
agcaggccagggccccagaatgcccaggcacaccccggctgtcccagagcagtgcccaca
cagtgcgacgtcccccctaacagccgcttcgactgtgcccctgacaaggccatcacccag
gaacagtgcgaggcccgcggctgctgctacatccctgcaaagcaggaacttcggagagcc
cagatgggacagccctggtgcttcttcccacccagctaccccagctacaagctggagaac
ctgagtgcctctgaaatgggctacacggccaccctgacccgtaccacccccaccttcttc
cccaaggacatcctgaccttgcggctggacgtgatgatggagactgagaaccgcctccac
ttcacgatcaaagatcccgctaacaagcgctacgaggtgcccttggagaccccgcgtgtc
cccagccgggcactgtccccactctacagcgtggagttctccgaggagcccttcggggtg
attgtgcgccggcagctggacggtcgtgtgctgctgaacacgacggtggcgcccctgttc
tttgcggaccagttccttcagttgtccacctcgctgccctcgcagtacatcacaggactc
gccgagcacctcagtcccctgatgctcagcaccagctggaccaggatcaccctgtggaac
cgggacctcgcgcccacgcccggtgcaaacctctacgggtctcaccctttctacctggcg
ctggaggatggcgggtcggcacatggggtgttcctgctgaacagcaatgccatggatgtg
gtcctgcagccgagccctgcccttagctggaggtcgacaggtgggatcctggatgtgtac
atcttcctgggcccggagcccaagagcgtggtgcggcagtacctggatgttgtgggatac
ccgttcatgccgccatactggggcctgggcttccacctgtgccgctggggctactcctcc
accgccatcacccgccaggtggtggagaacatgaccagggcccacttccccctggacgtc
cagtggaacgacttggactacatggactcccggagggacttcacgttcaacaaggatggc
ttccgggacttcccagccatggtgcaggagctgcaccagggcggccggcgctacgtgatg
attgtggatcctgccatcagcagctcgggccctgccgggagctacagaccctacgacgag
ggtctgcggagggcggttttcatcaccaacgagaccggccagccgctgatcgggaaggtg
tggcctgggtccactgccttccccgacttcaccaaccccgcagccctggcctggtgggag
gacatggtggctgagttccatgaccaggtgcccttcgacggcatgtggattgacatgaac
gagccttccaacttcatcaggggctctgaggacggctgcccccacaatgagctggaggag
ccaccctacgtgcctggggtggttggggggaccctccaggcggccaccatctgtgcctcc
agccaccagttcctctctacacactacaacctgcacaacctctacggcctgactgaagcc
atcgcctcctacagggcactggtgaaggctcgggggacacgcccatttgtgatctcccgc
tcgacctttgctggccacggccgatatgccggccactggacgggggacgtgtggagctcc
tgggagcagctcgccgcctccgtgccagaaatcctgcagtttaacctgctgggggtgcct
ctggtcggggccgacgtctgcggcttcctgggcaacacctcagaggagctgtgtgtgcgc
tggacccagctgggggccttctacccctttatgcggaaccacaacggcctgctcaatctg
ccccaggagccatacagtttcagcgagccagcccagcaggccatgaggaaggccctcacc
ctgcgctacgcactcctcccccacctctacacgctgttccaccaggcccacgtcgctggg
gagaccgtggcccggcctctcttcctggagttccccgaggactctagcacctggactgtg
gaccaccagctcctgtggggggaggccctgctcatcaccccagtgctgcaggccgggaag
gccgaagtgaccggctacttcccctcaggcacatggtacgacctggagacggtgccaata
gaggcccttggcagcctcccgcccccacctgcagctccccgtgagccagccatccacagc
gaggggcagtgggtgacactgccagcccccctggacaccatcaacgtccacctccgggct
gggcacatcatccccctgcagggccctggcctcacaaccacagagtcccgccagcagccc
atggccctggctgtggccctgaccaagggtggggaggcccgaggggagctgttctgggac
gatggagagagcctggaagtgctggagcgaggggcctacacacaggtcatattcctggcc
aggagtaacacggtcatgaatgagctggtacatgtgaccagcgagggggctggcctgcag
ctgcagaaggtgaccgtcctgggcgtggccacagcgccccagcaggtcctctccaacggc
gcccctgtctccaacttcacctacagccccgacaccaaggtcctggacatccctgtctcg
ctgttggtgggagagcagtttctcatcagctggtcttag

DBGET integrated database retrieval system