KEGG   Macaca fascicularis (crab-eating macaque): 102142907Help
Entry
102142907         CDS       T02918                                 

Gene name
WDHD1
Definition
(RefSeq) WD repeat and HMG-box DNA binding protein 1
  KO
K11274  chromosome transmission fidelity protein 4
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mcf03036]
    102142907 (WDHD1)
Chromosome and associated proteins [BR:mcf03036]
 Eukaryotic type
  Sister chromatid cohesion proteins
   Other sister chromatid cohesion factors
    102142907 (WDHD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Mcl1_mid WD40 ANAPC4_WD40 eIF2A HMG_box HMG_box_2
Motif
Other DBs
NCBI-GeneID: 102142907
NCBI-ProteinID: XP_005561363
UniProt: A0A2K5V5I1
LinkDB All DBs
Position
7
AA seq 1127 aa AA seqDB search
MPATRKPMRYGHTEGHTEVCFDDSGSFIVTCGSDGDVRIWEDLDDDDPKFINVGEKAYSC
ALKNGKLVTAVSNNTIQVHTFPEGVPDGILTRFTTNANHVVFNGDGAKIAAGSSDFLVKI
VDVMDSSQQKTFRGHDAPVLSLSFDPKDIFLASASCDGSVRVWQISDQTCAISWPLLQKC
NDVINAKSICRLAWQPKSGKLLAIPVEKSVKLYRRETWSHQFDLSDNFISQTLNIVTWSP
CGQYLAAGSINGLIIVWNVETKDCMERVKHEKGYAICGLAWHPTCGRISYTDAEGNLGLL
ENVCDPSGKTSSSKVSSRVEKDYNDLFDGDDMSNTGDFLNDNAVEIPSFSKGIINDDEDD
DLMMASGRLRQRSHILEDDENSVDISMLKTGSSLLKEEEEDGQEGSIHNLPLVTSQRPFY
DGPMPTPRQKPFQSGSTPLHLTHRFMVWNSIGIIRCYNDEQDNAIDVEFHDSSIHHATHL
SNTLNYTIADLSHEAILLACESTDELASKLHCLHFSSWDSSKEWIIDLPQNEDIEAICLG
QGWAAAATSALLLRLFTIGGVQKEVFSLAGPVVSMAGHGEQLFIVYHRGTGFDGDQCLGV
QLLELGKKKKQIVHGDPLPLTRKSYLAWIGFSAEGTPCYVDSEGIVRMLNRGLGNTWTPV
CNTREHCKGKSDHYWVVGIHENPQQLRCIPCKGSRFPPTLPRPAVAILSFKLPYCQIATE
KGQMEEQFWRSVIFHNHLDYLAKNGYEYEESTKKQATKEQQELLMKMLALSCKLEREFRC
VELADLMTQNAVNLAIKYASRSRKLILAQKLSELAVEKAAELTATQVEEGEEEEDFRKKL
NAGYSNTATEWSQPRFRNQVEEDAEDSGEADDEEKPEIHKPGQNSFSKSTNSSDISAKSG
AVTFSSQGRVNPFKVSASSKEPAMSMNSARSTNILDNMGKSSKKSTALNRTTNNEKSPII
KPLIPKPKPKQASAASYFQKRNSQTNKTEEVKEENPKNVLSETPAICPQNTENQRPKTGF
QMWLEENRSNILSDNPDFSDEADIIKEGMIRFRVLSTEERKAWANKAKGEKASDGAEAKK
RNRVVDESDETENQEEKTKENLNLPKKQKPLDFSTNQKLSAFAFKQE
NT seq 3384 nt NT seq  +upstreamnt  +downstreamnt
atgccggccacacggaagccaatgagatatggacatacagagggacacacggaggtctgt
tttgatgattctgggagttttattgtgacttgtggaagtgatggtgatgtgaggatttgg
gaagacttggatgatgatgatcctaagttcattaatgttggagaaaaggcatattcatgt
gctttgaagaatggaaaattggtcactgcagtttctaataatactattcaagtccacaca
tttcctgaaggcgttccagatggtatattgactcgcttcactacaaatgcaaaccatgtg
gtctttaatggggatggtgctaaaattgctgctggatctagtgattttctagtcaaaatt
gtggatgtgatggatagcagccaacagaaaacatttcgaggacatgatgcccctgtttta
agtctttcctttgatcctaaggacatctttctggcatcagctagttgtgatggatctgtc
agagtgtggcaaatttcagatcagacatgtgctattagttggccactgctacaaaaatgc
aacgatgtgataaatgcaaaatcaatctgcagacttgcttggcagccaaaaagtgggaag
ttactggcaattcctgtggaaaaatctgttaagctatatagaagagaaacttggagtcat
caatttgatctttcagataatttcatctctcagaccctcaatatagtaacctggtctccc
tgtgggcaatatttagctgcaggtagtattaatggtctaattatagtttggaatgtggaa
accaaagactgcatggaaagggtgaaacatgagaaaggttatgcaatttgtggtctggca
tggcatcctacttgtggtcgaatatcatatactgatgcagaaggaaatctagggcttcta
gagaatgtttgtgaccccagtggaaagacatcaagcagtaaggtatctagcagagtggaa
aaggattacaatgatctttttgatggtgatgatatgagtaatactggtgattttctaaat
gacaatgcagtcgagatcccttctttttcaaaagggattataaatgatgatgaagatgat
gacctcatgatggcttcaggtcgtcttagacaacgaagtcacatcctagaagatgatgaa
aactcagttgatatttcaatgctaaaaactggttctagtcttctcaaagaggaggaggaa
gatggtcaggaaggcagcattcacaatctaccacttgtaacatcccaaaggccattttat
gatggacccatgccaactcccaggcaaaagccatttcagtcgggttctacacccttgcat
ctcactcacagattcatggtgtggaactctattggaattattcgctgctataatgatgag
caagacaatgccatagatgtggagttccatgattcctccatacaccatgcaacacactta
tcaaacactttgaattatacaatagcagatctttctcacgaagctattttgttggcatgt
gaaagcactgatgaactagcaagcaagcttcactgcctgcactttagttcttgggattca
agcaaagagtggataatagacttgcctcagaatgaggatatcgaagccatatgtctcggt
caaggatgggctgctgccgcaactagtgccctgcttcttcgattgtttactattggaggg
gttcagaaagaggtattcagccttgctggacctgtggtgtcaatggcaggacatggagaa
cagcttttcattgtttatcacagaggtacaggatttgatggggatcagtgccttggagtt
caactgctagagctggggaaaaagaaaaaacaaattgtgcatggtgaccctcttcctctt
acaaggaaatcctaccttgcatggattgggttttcagctgaaggtaccccttgttacgtg
gattcagaaggaattgttcgaatgcttaacagaggacttggtaatacatggactcctgta
tgtaatacaagagagcactgcaaaggaaaatctgatcactactgggtggttggtatccat
gaaaatccccagcaactaaggtgcattccttgtaaaggttctcggtttcccccaaccctt
ccacgccctgccgttgctatattatcctttaagcttccttattgtcagattgcaacagag
aaaggacaaatggaggagcagttttggcgttcagttatatttcacaaccaccttgattat
ttagctaaaaatggttatgaatacgaagagagcactaaaaagcaagcaacaaaagagcaa
caggaacttttaatgaaaatgcttgcgctttcttgtaaactggagcgggaattccgttgt
gtggaacttgctgatctaatgactcaaaatgctgtgaatttagccattaaatatgcttct
cgctctcggaaattaatactagctcaaaaacttagtgaactggctgtagagaaggcagct
gaattgacagcaacccaggtggaagagggagaagaagaagaagatttcagaaaaaagctg
aatgctggttacagcaatactgctacagagtggagccaaccaaggttcagaaatcaagtt
gaagaagatgccgaggacagtggagaagctgatgatgaagaaaaaccagaaatacataag
cctggacagaactcattttccaaaagtacaaattcctccgatatttcagctaagtcaggt
gcagttacctttagcagccaaggacgagtaaatccctttaaggtatcagccagttccaaa
gaaccagccatgtcaatgaattcagcacgttcaactaatattttagacaatatgggcaaa
tcatccaagaaatccactgcacttaatcgaactacaaataatgaaaagtctcccattata
aagcctctgattccaaagccgaagcctaagcaggcatctgcagcatcctatttccagaaa
agaaattctcaaactaataaaactgaggaagtgaaagaagaaaatcctaaaaatgtatta
tctgaaaccccagctatatgtcctcaaaacactgaaaaccaaaggccaaagactgggttc
cagatgtggctagaagaaaatagaagtaacattttgtctgacaatcctgacttttcagat
gaagcagacataataaaagaaggaatgattcggtttagagtattgtcaactgaagaaaga
aaggcatgggctaacaaagccaaaggagaaaaggcaagtgatggagctgaagcaaagaag
cgaaaccgtgtggttgatgaaagcgatgaaacagaaaaccaggaagaaaaaacaaaagag
aatctgaatttgcctaaaaagcagaaacctttagatttttctacaaatcagaaactatca
gcttttgcatttaagcaggagtaa

DBGET integrated database retrieval system