KEGG   Macaca fascicularis (crab-eating macaque): 102144240Help
Entry
102144240         CDS       T02918                                 

Gene name
THPO
Definition
(RefSeq) thrombopoietin
  KO
K06854  thrombopoietin
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04060  Cytokine-cytokine receptor interaction
mcf04630  Jak-STAT signaling pathway
mcf04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    102144240 (THPO)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102144240 (THPO)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102144240 (THPO)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcf04052]
    102144240 (THPO)
Cytokines and growth factors [BR:mcf04052]
 Cytokines
  CSF and other factors
   102144240 (THPO)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EPO_TPO
Motif
Other DBs
NCBI-GeneID: 102144240
NCBI-ProteinID: XP_005546625
UniProt: A0A2K5VM44
LinkDB All DBs
Position
2
AA seq 353 aa AA seqDB search
MELTELLLVVMLLLTARLTLSSPAPPACDPRVLSKLLRDSRVLHSRLSLCPEVNPLPTPV
LLPAVDFSLGEWKTQMEETKAQDILGAVTLLLEGVMAARGQLGPTCLSSLLGQLSGQVRL
LLGALQSLLGTQLPPQGRTTAHKDPNAIFLSFQHLLRGKVRFLLLVGGPTLCVRRAPPTT
AVPSRTSLVLTLNELPNRTSGLLETNFTASARTTGSGLQKRQQGFRAKIPGLLNQTSRSL
DQIPGYLNRIHKLLNGTRGLFPGPSRRTLGAPDISPGTSDTGSLPPNLQPGYSPSPTHPP
TGQYTLFPLPPTLPSPVVQLHPLLPDPSAPTPTPTSPLLNTSHTHSQNLSQEG
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atggagctgactgaattgctcctcgtggtcatgcttctcctaactgcaaggctaactctg
tccagcccggctcctcctgcctgtgacccccgagtcctcagtaaactgcttcgtgactcc
cgtgtccttcacagcagactgagcctgtgcccagaggttaaccctttacccacacctgtc
ctgctgcctgctgtggactttagcttgggagaatggaaaacccagatggaggagaccaag
gcacaggacattctgggagcagtgacccttctgctggagggagtgatggcagcacgggga
caactgggacccacttgcctctcatcccttctggggcagctttctggacaggtccgtctc
ctcctcggggccctgcagagcctccttggaacccagcttcctccacagggcaggaccaca
gctcacaaggatcccaatgccatcttcctgagcttccaacacctgctccgaggaaaggtg
cgtttcctgctgcttgtaggagggcccaccctctgcgtcaggcgggccccacccaccaca
gctgtccccagcagaacctctctagtcctcacactgaacgagctcccaaacaggacttct
ggattgttggagacaaacttcactgcctcggccagaactactggctctggacttcagaag
cggcagcagggattcagagccaagattcctggtctgctgaaccaaacctccaggtccctg
gaccaaatccccggatacctgaacaggatacacaaactcttgaatggaactcgtggactc
tttcctggaccctcacgcaggaccctaggagccccggacatttccccaggaacatcagac
acaggctccctgccacccaacctccagcctggatattctccttccccaacccatccccct
actggacagtacacactcttccctcttccacccaccttgccctcccctgtggtccagctc
caccccctgcttcctgacccttctgctccaacacccacccctaccagccctcttctaaac
acatcccacacccactcccagaatctgtctcaggaagggtaa

DBGET integrated database retrieval system