KEGG   Macaca fascicularis (crab-eating macaque): 102144868
Entry
102144868         CDS       T02918                                 

Gene name
RASSF1
Definition
(RefSeq) Ras association domain family member 1
  KO
K09850  Ras association domain-containing protein 1
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04014  Ras signaling pathway
mcf04390  Hippo signaling pathway
mcf04392  Hippo signaling pathway - multiple species
mcf05200  Pathways in cancer
mcf05206  MicroRNAs in cancer
mcf05219  Bladder cancer
mcf05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    102144868 (RASSF1)
   04390 Hippo signaling pathway
    102144868 (RASSF1)
   04392 Hippo signaling pathway - multiple species
    102144868 (RASSF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102144868 (RASSF1)
   05206 MicroRNAs in cancer
    102144868 (RASSF1)
  09162 Cancer: specific types
   05219 Bladder cancer
    102144868 (RASSF1)
   05223 Non-small cell lung cancer
    102144868 (RASSF1)
SSDB
Motif
Pfam: RA Nore1-SARAH C1_1 Mst1_SARAH
Other DBs
NCBI-GeneID: 102144868
NCBI-ProteinID: XP_005547278
UniProt: A0A2K5V3H2
LinkDB
Position
2
AA seq 340 aa
MSAEPELIELRELAPAGRAGQGRTRLERANALRIARGTACNPARQLIPGRGHRFQPAGPA
THTWCDLCGDFIWGVVRKGLQCAHCKFTCHYRCRALVCLDCCGPRDLGWEPAVERDTNVD
EPVEWETPDLSQAEIEQKIKEYNAQINSNLFMSLNKDGSYTGFIKVQLKLVRPVSVPSSK
KPPSLQDARRGPGRGTSVRRRTSFYLPKDAVKHLHVLSRTKAREVIEALLRKFLVVDDPR
KFALFERAERHGQVYLRKLLDDEQPLRLRLLAGPSDKALSFVLKENDSGEVNWDAFSMPE
LHNFLRILQREEEEHLRQILQKYSYCRQKIQEALHACPLG
NT seq 1023 nt   +upstreamnt  +downstreamnt
atgtcggcggagcctgagctcattgagctgcgggagctggcacccgctgggcgcgctggg
cagggccgcacccggctggagcgtgccaacgcgctgcgcatcgcgcggggcaccgcgtgc
aaccccgcacggcagctgatcccgggccgtggccaccgcttccagcctgcggggcccgcc
acgcacacgtggtgcgacctctgtggcgacttcatctggggcgtcgtgcgcaagggcctg
cagtgcgcgcattgcaagttcacctgccactaccgctgccgcgcgctcgtctgcctggac
tgctgcgggccccgggacctgggctgggaacccgcggtggagcgggacacgaacgtggac
gagcccgtggagtgggagacacctgacctttctcaagctgagattgagcagaagatcaag
gagtacaatgcccagatcaatagcaaccttttcatgagcttgaacaaggatggttcttac
acaggcttcatcaaggttcagctgaagctggtgcgccctgtctctgtgccctccagcaag
aagccaccctccttgcaggatgcccggcggggcccaggacggggcacgagtgtcaggcgc
cgcacttccttttacctgcccaaggatgctgtcaagcacctgcatgtgctgtcacgcaca
aaggcacgtgaagtcattgaggccctgctgcgaaagttcttggtggtggatgacccccgc
aagtttgcactctttgagcgggctgagcgtcatggccaagtgtacttgcggaagctgttg
gatgatgagcagcccctgcggctgcggctcctggcagggcccagtgacaaggccctgagc
ttcgtcctgaaggaaaatgactctggggaggtgaactgggatgccttcagcatgcctgaa
ttacataacttcctgcgtatcctgcagcgggaggaggaggagcacctccgccagatcctg
cagaagtactcctattgccgccagaagatccaagaggccctgcacgcctgccccctcggg
tga

DBGET integrated database retrieval system