KEGG   Macaca fascicularis (crab-eating macaque): 102145011
Entry
102145011         CDS       T02918                                 
Symbol
MAPK1
Name
(RefSeq) mitogen-activated protein kinase 1
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf01521  EGFR tyrosine kinase inhibitor resistance
mcf01522  Endocrine resistance
mcf01524  Platinum drug resistance
mcf04010  MAPK signaling pathway
mcf04012  ErbB signaling pathway
mcf04014  Ras signaling pathway
mcf04015  Rap1 signaling pathway
mcf04022  cGMP-PKG signaling pathway
mcf04024  cAMP signaling pathway
mcf04062  Chemokine signaling pathway
mcf04066  HIF-1 signaling pathway
mcf04068  FoxO signaling pathway
mcf04071  Sphingolipid signaling pathway
mcf04072  Phospholipase D signaling pathway
mcf04114  Oocyte meiosis
mcf04140  Autophagy - animal
mcf04148  Efferocytosis
mcf04150  mTOR signaling pathway
mcf04151  PI3K-Akt signaling pathway
mcf04210  Apoptosis
mcf04218  Cellular senescence
mcf04261  Adrenergic signaling in cardiomyocytes
mcf04270  Vascular smooth muscle contraction
mcf04350  TGF-beta signaling pathway
mcf04360  Axon guidance
mcf04370  VEGF signaling pathway
mcf04371  Apelin signaling pathway
mcf04380  Osteoclast differentiation
mcf04510  Focal adhesion
mcf04520  Adherens junction
mcf04540  Gap junction
mcf04550  Signaling pathways regulating pluripotency of stem cells
mcf04611  Platelet activation
mcf04613  Neutrophil extracellular trap formation
mcf04620  Toll-like receptor signaling pathway
mcf04621  NOD-like receptor signaling pathway
mcf04625  C-type lectin receptor signaling pathway
mcf04650  Natural killer cell mediated cytotoxicity
mcf04657  IL-17 signaling pathway
mcf04658  Th1 and Th2 cell differentiation
mcf04659  Th17 cell differentiation
mcf04660  T cell receptor signaling pathway
mcf04662  B cell receptor signaling pathway
mcf04664  Fc epsilon RI signaling pathway
mcf04666  Fc gamma R-mediated phagocytosis
mcf04668  TNF signaling pathway
mcf04713  Circadian entrainment
mcf04720  Long-term potentiation
mcf04722  Neurotrophin signaling pathway
mcf04723  Retrograde endocannabinoid signaling
mcf04724  Glutamatergic synapse
mcf04725  Cholinergic synapse
mcf04726  Serotonergic synapse
mcf04730  Long-term depression
mcf04810  Regulation of actin cytoskeleton
mcf04910  Insulin signaling pathway
mcf04912  GnRH signaling pathway
mcf04914  Progesterone-mediated oocyte maturation
mcf04915  Estrogen signaling pathway
mcf04916  Melanogenesis
mcf04917  Prolactin signaling pathway
mcf04919  Thyroid hormone signaling pathway
mcf04921  Oxytocin signaling pathway
mcf04926  Relaxin signaling pathway
mcf04928  Parathyroid hormone synthesis, secretion and action
mcf04929  GnRH secretion
mcf04930  Type II diabetes mellitus
mcf04933  AGE-RAGE signaling pathway in diabetic complications
mcf04934  Cushing syndrome
mcf04935  Growth hormone synthesis, secretion and action
mcf04960  Aldosterone-regulated sodium reabsorption
mcf05010  Alzheimer disease
mcf05020  Prion disease
mcf05022  Pathways of neurodegeneration - multiple diseases
mcf05034  Alcoholism
mcf05132  Salmonella infection
mcf05133  Pertussis
mcf05135  Yersinia infection
mcf05140  Leishmaniasis
mcf05142  Chagas disease
mcf05145  Toxoplasmosis
mcf05152  Tuberculosis
mcf05160  Hepatitis C
mcf05161  Hepatitis B
mcf05163  Human cytomegalovirus infection
mcf05164  Influenza A
mcf05165  Human papillomavirus infection
mcf05166  Human T-cell leukemia virus 1 infection
mcf05167  Kaposi sarcoma-associated herpesvirus infection
mcf05170  Human immunodeficiency virus 1 infection
mcf05171  Coronavirus disease - COVID-19
mcf05200  Pathways in cancer
mcf05203  Viral carcinogenesis
mcf05205  Proteoglycans in cancer
mcf05206  MicroRNAs in cancer
mcf05207  Chemical carcinogenesis - receptor activation
mcf05208  Chemical carcinogenesis - reactive oxygen species
mcf05210  Colorectal cancer
mcf05211  Renal cell carcinoma
mcf05212  Pancreatic cancer
mcf05213  Endometrial cancer
mcf05214  Glioma
mcf05215  Prostate cancer
mcf05216  Thyroid cancer
mcf05218  Melanoma
mcf05219  Bladder cancer
mcf05220  Chronic myeloid leukemia
mcf05221  Acute myeloid leukemia
mcf05223  Non-small cell lung cancer
mcf05224  Breast cancer
mcf05225  Hepatocellular carcinoma
mcf05226  Gastric cancer
mcf05230  Central carbon metabolism in cancer
mcf05231  Choline metabolism in cancer
mcf05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mcf05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102145011 (MAPK1)
   04012 ErbB signaling pathway
    102145011 (MAPK1)
   04014 Ras signaling pathway
    102145011 (MAPK1)
   04015 Rap1 signaling pathway
    102145011 (MAPK1)
   04350 TGF-beta signaling pathway
    102145011 (MAPK1)
   04370 VEGF signaling pathway
    102145011 (MAPK1)
   04371 Apelin signaling pathway
    102145011 (MAPK1)
   04668 TNF signaling pathway
    102145011 (MAPK1)
   04066 HIF-1 signaling pathway
    102145011 (MAPK1)
   04068 FoxO signaling pathway
    102145011 (MAPK1)
   04072 Phospholipase D signaling pathway
    102145011 (MAPK1)
   04071 Sphingolipid signaling pathway
    102145011 (MAPK1)
   04024 cAMP signaling pathway
    102145011 (MAPK1)
   04022 cGMP-PKG signaling pathway
    102145011 (MAPK1)
   04151 PI3K-Akt signaling pathway
    102145011 (MAPK1)
   04150 mTOR signaling pathway
    102145011 (MAPK1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102145011 (MAPK1)
   04148 Efferocytosis
    102145011 (MAPK1)
  09143 Cell growth and death
   04114 Oocyte meiosis
    102145011 (MAPK1)
   04210 Apoptosis
    102145011 (MAPK1)
   04218 Cellular senescence
    102145011 (MAPK1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102145011 (MAPK1)
   04520 Adherens junction
    102145011 (MAPK1)
   04540 Gap junction
    102145011 (MAPK1)
   04550 Signaling pathways regulating pluripotency of stem cells
    102145011 (MAPK1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102145011 (MAPK1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102145011 (MAPK1)
   04613 Neutrophil extracellular trap formation
    102145011 (MAPK1)
   04620 Toll-like receptor signaling pathway
    102145011 (MAPK1)
   04621 NOD-like receptor signaling pathway
    102145011 (MAPK1)
   04625 C-type lectin receptor signaling pathway
    102145011 (MAPK1)
   04650 Natural killer cell mediated cytotoxicity
    102145011 (MAPK1)
   04660 T cell receptor signaling pathway
    102145011 (MAPK1)
   04658 Th1 and Th2 cell differentiation
    102145011 (MAPK1)
   04659 Th17 cell differentiation
    102145011 (MAPK1)
   04657 IL-17 signaling pathway
    102145011 (MAPK1)
   04662 B cell receptor signaling pathway
    102145011 (MAPK1)
   04664 Fc epsilon RI signaling pathway
    102145011 (MAPK1)
   04666 Fc gamma R-mediated phagocytosis
    102145011 (MAPK1)
   04062 Chemokine signaling pathway
    102145011 (MAPK1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102145011 (MAPK1)
   04929 GnRH secretion
    102145011 (MAPK1)
   04912 GnRH signaling pathway
    102145011 (MAPK1)
   04915 Estrogen signaling pathway
    102145011 (MAPK1)
   04914 Progesterone-mediated oocyte maturation
    102145011 (MAPK1)
   04917 Prolactin signaling pathway
    102145011 (MAPK1)
   04921 Oxytocin signaling pathway
    102145011 (MAPK1)
   04926 Relaxin signaling pathway
    102145011 (MAPK1)
   04935 Growth hormone synthesis, secretion and action
    102145011 (MAPK1)
   04919 Thyroid hormone signaling pathway
    102145011 (MAPK1)
   04928 Parathyroid hormone synthesis, secretion and action
    102145011 (MAPK1)
   04916 Melanogenesis
    102145011 (MAPK1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102145011 (MAPK1)
   04270 Vascular smooth muscle contraction
    102145011 (MAPK1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    102145011 (MAPK1)
  09156 Nervous system
   04724 Glutamatergic synapse
    102145011 (MAPK1)
   04725 Cholinergic synapse
    102145011 (MAPK1)
   04726 Serotonergic synapse
    102145011 (MAPK1)
   04720 Long-term potentiation
    102145011 (MAPK1)
   04730 Long-term depression
    102145011 (MAPK1)
   04723 Retrograde endocannabinoid signaling
    102145011 (MAPK1)
   04722 Neurotrophin signaling pathway
    102145011 (MAPK1)
  09158 Development and regeneration
   04360 Axon guidance
    102145011 (MAPK1)
   04380 Osteoclast differentiation
    102145011 (MAPK1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    102145011 (MAPK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102145011 (MAPK1)
   05206 MicroRNAs in cancer
    102145011 (MAPK1)
   05205 Proteoglycans in cancer
    102145011 (MAPK1)
   05207 Chemical carcinogenesis - receptor activation
    102145011 (MAPK1)
   05208 Chemical carcinogenesis - reactive oxygen species
    102145011 (MAPK1)
   05203 Viral carcinogenesis
    102145011 (MAPK1)
   05230 Central carbon metabolism in cancer
    102145011 (MAPK1)
   05231 Choline metabolism in cancer
    102145011 (MAPK1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102145011 (MAPK1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102145011 (MAPK1)
   05212 Pancreatic cancer
    102145011 (MAPK1)
   05225 Hepatocellular carcinoma
    102145011 (MAPK1)
   05226 Gastric cancer
    102145011 (MAPK1)
   05214 Glioma
    102145011 (MAPK1)
   05216 Thyroid cancer
    102145011 (MAPK1)
   05221 Acute myeloid leukemia
    102145011 (MAPK1)
   05220 Chronic myeloid leukemia
    102145011 (MAPK1)
   05218 Melanoma
    102145011 (MAPK1)
   05211 Renal cell carcinoma
    102145011 (MAPK1)
   05219 Bladder cancer
    102145011 (MAPK1)
   05215 Prostate cancer
    102145011 (MAPK1)
   05213 Endometrial cancer
    102145011 (MAPK1)
   05224 Breast cancer
    102145011 (MAPK1)
   05223 Non-small cell lung cancer
    102145011 (MAPK1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102145011 (MAPK1)
   05170 Human immunodeficiency virus 1 infection
    102145011 (MAPK1)
   05161 Hepatitis B
    102145011 (MAPK1)
   05160 Hepatitis C
    102145011 (MAPK1)
   05171 Coronavirus disease - COVID-19
    102145011 (MAPK1)
   05164 Influenza A
    102145011 (MAPK1)
   05163 Human cytomegalovirus infection
    102145011 (MAPK1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102145011 (MAPK1)
   05165 Human papillomavirus infection
    102145011 (MAPK1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102145011 (MAPK1)
   05135 Yersinia infection
    102145011 (MAPK1)
   05133 Pertussis
    102145011 (MAPK1)
   05152 Tuberculosis
    102145011 (MAPK1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102145011 (MAPK1)
   05140 Leishmaniasis
    102145011 (MAPK1)
   05142 Chagas disease
    102145011 (MAPK1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102145011 (MAPK1)
   05020 Prion disease
    102145011 (MAPK1)
   05022 Pathways of neurodegeneration - multiple diseases
    102145011 (MAPK1)
  09165 Substance dependence
   05034 Alcoholism
    102145011 (MAPK1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    102145011 (MAPK1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    102145011 (MAPK1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102145011 (MAPK1)
   04934 Cushing syndrome
    102145011 (MAPK1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102145011 (MAPK1)
   01524 Platinum drug resistance
    102145011 (MAPK1)
   01522 Endocrine resistance
    102145011 (MAPK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcf01001]
    102145011 (MAPK1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mcf03036]
    102145011 (MAPK1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcf04147]
    102145011 (MAPK1)
Enzymes [BR:mcf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     102145011 (MAPK1)
Protein kinases [BR:mcf01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   102145011 (MAPK1)
Chromosome and associated proteins [BR:mcf03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     102145011 (MAPK1)
Exosome [BR:mcf04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102145011 (MAPK1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH Haspin_kinase Choline_kinase FTA2 Kdo
Other DBs
NCBI-GeneID: 102145011
NCBI-ProteinID: XP_005567920
Ensembl: ENSMFAG00000002042
UniProt: A0A2K5TXF6
LinkDB
Position
10:91220979..91330485
AA seq 360 aa
MAAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFE
HQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQH
LSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDH
TGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHI
LGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHK
RIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
NT seq 1083 nt   +upstreamnt  +downstreamnt
atggcggcggcggcggcggcgggcgcgggcccggagatggtccgcgggcaggtgttcgac
gtgggaccgcgctacaccaacctctcgtacatcggcgagggtgcctacggcatggtgtgc
tctgcttatgataatgtcaacaaagttcgagtagctatcaagaaaatcagcccctttgag
caccagacctactgccagagaaccctgcgggagataaaaatcttactgcgcttcagacat
gagaacatcattggaatcaatgacattattcgagcaccaaccatcgagcaaatgaaagat
gtatatatagtacaagacctcatggaaacagatctttacaagctcttgaagacacaacac
ctcagcaacgaccatatctgctattttctttaccagatcctcagagggttaaaatatatc
cattcagctaacgttctgcaccgtgacctcaagccttccaacctgctgctcaacaccacc
tgtgatctcaagatctgtgactttggcctggcccgtgttgcagatccagaccatgatcac
acagggttcctgacagaatatgtggctacacgttggtacagggctccagaaattatgttg
aattccaagggctacaccaagtccattgatatttggtctgtaggctgcattctggcagaa
atgctttctaacaggcccatctttccagggaagcattatcttgaccagctgaaccacatt
ctgggtattcttggatccccatcacaagaagacctgaattgtataataaatttaaaagct
aggaactatttgctttctcttccacacaaaaataaggtgccgtggaacaggctgttccca
aatgctgactccaaagctctggacttactggacaaaatgttgacattcaaccctcacaag
aggattgaagtagaacaggctctggcccacccatatctggagcagtattacgacccgagt
gacgagcccattgccgaagcaccattcaaattcgacatggaattggatgacttgcctaag
gaaaagctcaaagaactaatttttgaagagactgctagattccagccgggatacagatct
taa

DBGET integrated database retrieval system