KEGG   Macaca fascicularis (crab-eating macaque): 102145541
Entry
102145541         CDS       T02918                                 

Gene name
TGFA
Definition
(RefSeq) transforming growth factor alpha
  KO
K08774  transforming growth factor, alpha
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf01521  EGFR tyrosine kinase inhibitor resistance
mcf04010  MAPK signaling pathway
mcf04012  ErbB signaling pathway
mcf04014  Ras signaling pathway
mcf04151  PI3K-Akt signaling pathway
mcf04915  Estrogen signaling pathway
mcf05200  Pathways in cancer
mcf05210  Colorectal cancer
mcf05211  Renal cell carcinoma
mcf05212  Pancreatic cancer
mcf05214  Glioma
mcf05215  Prostate cancer
mcf05223  Non-small cell lung cancer
mcf05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102145541 (TGFA)
   04012 ErbB signaling pathway
    102145541 (TGFA)
   04014 Ras signaling pathway
    102145541 (TGFA)
   04151 PI3K-Akt signaling pathway
    102145541 (TGFA)
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    102145541 (TGFA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102145541 (TGFA)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102145541 (TGFA)
   05212 Pancreatic cancer
    102145541 (TGFA)
   05225 Hepatocellular carcinoma
    102145541 (TGFA)
   05214 Glioma
    102145541 (TGFA)
   05211 Renal cell carcinoma
    102145541 (TGFA)
   05215 Prostate cancer
    102145541 (TGFA)
   05223 Non-small cell lung cancer
    102145541 (TGFA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102145541 (TGFA)
SSDB
Motif
Pfam: EGF EGF_2 TMEM154
Other DBs
NCBI-GeneID: 102145541
NCBI-ProteinID: XP_005575709
UniProt: A0A2K5VQF7
LinkDB
Position
13
AA seq 159 aa
MVPSAGQLALFALGIVLAACQALENSTSLLSDPPVAAAVVSHFNDCPDSHTQFCFHGTCR
FLVQEDKPACVCHSGYVGARCEHADLLAVVAASQKKQAITALVVVSIVALAVLIITCVLI
HCCQVRKHCEWCRALICRHEKPSALLKGRTACCHSETVV
NT seq 480 nt   +upstreamnt  +downstreamnt
atggtcccctcggctggacagctcgccctgttcgcgctgggtattgtgttggcagcgtgc
caggccttggagaacagcacgtccctgctgagcgacccgcccgtggctgcagcagtggtg
tcccattttaatgactgcccagattcccacactcagttctgtttccatggaacctgcagg
tttttggtgcaggaggacaagccagcatgtgtctgccattctgggtacgttggtgcacgc
tgtgagcatgcggacctcctggctgtggtggccgccagtcagaagaagcaggccatcacc
gccttggtggtggtctccatcgtggccctggctgtccttatcatcacatgtgtgctgata
cactgctgccaggtccgaaaacactgtgagtggtgccgggccctcatctgccggcacgag
aagcccagcgccctcctaaagggaagaaccgcttgctgccactcagaaacagtggtctga

DBGET integrated database retrieval system