KEGG   Macaca fascicularis (crab-eating macaque): 102145640Help
Entry
102145640         CDS       T02918                                 

Gene name
ABAT
Definition
(RefSeq) 4-aminobutyrate aminotransferase
  KO
K13524  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf00250  Alanine, aspartate and glutamate metabolism
mcf00280  Valine, leucine and isoleucine degradation
mcf00410  beta-Alanine metabolism
mcf00640  Propanoate metabolism
mcf00650  Butanoate metabolism
mcf01100  Metabolic pathways
mcf04727  GABAergic synapse
Module
mcf_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:mcf00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    102145640 (ABAT)
   00650 Butanoate metabolism
    102145640 (ABAT)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    102145640 (ABAT)
   00280 Valine, leucine and isoleucine degradation
    102145640 (ABAT)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    102145640 (ABAT)
 Organismal Systems
  Nervous system
   04727 GABAergic synapse
    102145640 (ABAT)
Enzymes [BR:mcf01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     102145640 (ABAT)
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     102145640 (ABAT)
Amino acid related enzymes [BR:mcf01007]
 Aminotransferase (transaminase)
  Class III
   102145640 (ABAT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_3 Lenti_VIF_2 Aminotran_1_2 Tex_N
Motif
Other DBs
NCBI-GeneID: 102145640
NCBI-ProteinID: XP_005591265
UniProt: G7Q0G5
LinkDB All DBs
Position
20
AA seq 500 aa AA seqDB search
MASMLLARHLACSFQHSYRLLVPGSRHISQAAAKVDVEFDYDGPLMKTEVPGPRSRALMK
QLNIIQNAEAVHFFCNYEESRGNYLVDVDGNRMLDLYSQISSVPIGYSHPALLKLIQQPQ
NASMFVNRPALGILPPENFVEKLRESLLSVAPKGMSQLITMACGSCSNENAFKTIFMWYR
SKERGQRGFSQEELETCMINQAPGCPDYSILSFMGAFHGRTMGCLATTHSKAIHKIDIPS
FDWPIAPFPRLKYPLEEFVKENQQEEARCLEEVEDLIVKYRKKKKTVAGIIVEPIQSEGG
DNHASDDFFRKLRDIARKHGCAFLVDEVQTGGGCTGKFWAHEHWGLDDPADVMTFSKKMM
IGGFFHKEEFRPNAPYRIFNTWLGDPSKNLLLAEVINIIKREDLLNNAAHAGKVLLTGLL
DLQARYPQFISRVRGRGTFCSFDTPDDSVRNKLILTARNKGVVLGGCGDKSIRFRPTLVF
RDHHAHLFLNIFSDILADFK
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggcctccatgttgctcgcccggcacctggcctgcagcttccagcacagctaccgcctg
ctggtgcccggatccagacacattagtcaagccgcagccaaagtcgacgttgaatttgat
tatgatgggcctctgatgaagacagaagtcccagggcctagatctcgggcgttaatgaaa
cagctgaatataattcagaatgcagaggctgtgcattttttctgcaattacgaagagagc
cgaggcaattacctggttgatgtggacggcaaccgaatgctggatctttattcccagatc
tcctctgtccccataggttacagccaccccgccctgctgaaactcatccaacagcctcaa
aatgcgagcatgttcgtcaacagacccgccctcggaatcctgcctccggagaactttgtg
gagaagctccgggagtccttgctctcggtggctcccaaagggatgtcccagctcatcacc
atggcctgcggctcctgctccaatgaaaatgccttcaagaccatcttcatgtggtaccgg
agcaaggaaagagggcagaggggcttctcccaggaggagctggagacgtgcatgattaac
caggcccccggctgccctgactacagcatcctctccttcatgggcgcgttccatgggagg
accatgggttgcttagcgaccacgcactccaaagccattcacaagattgacatcccttcc
tttgactggcccatcgcgccgttcccacggctgaaataccctctggaagagttcgtgaaa
gagaaccaacaggaggaggcccgctgtctggaagaggtggaggatctgattgtgaaatat
cggaaaaagaagaagacggtggccgggatcatcgtggagcccatccagtctgagggtgga
gacaaccatgcgtccgatgacttctttcggaagctgagagacattgccaggaagcatggc
tgcgccttcttggtggatgaggtccagaccggaggtggctgcacaggcaagttctgggcc
catgagcactggggcttggatgacccagcagacgtgatgaccttcagcaagaagatgatg
attgggggcttcttccacaaggaggagttcaggcccaatgctccttaccggatcttcaac
acctggctgggggacccgtccaagaacctactgctggctgaggtcatcaacatcatcaag
cgggaggacctgctaaataacgcagcccatgccgggaaggtcctgctcacgggattgctg
gacctccaggcccggtacccccagttcatcagcagggtgagaggacgaggcaccttttgc
tccttcgatactcccgatgattccgtacggaataagctcattttaactgccagaaacaaa
ggtgtggtgttggggggctgcggtgacaaatctattcgtttccgtcccacgctggtcttc
agggatcaccacgctcacctgttcctcaatattttcagtgacatcttagcagacttcaag
taa

DBGET integrated database retrieval system