KEGG   Macaca fascicularis (crab-eating macaque): 102145864Help
Entry
102145864         CDS       T02918                                 

Gene name
HK1
Definition
(RefSeq) hexokinase 1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf00010  Glycolysis / Gluconeogenesis
mcf00051  Fructose and mannose metabolism
mcf00052  Galactose metabolism
mcf00500  Starch and sucrose metabolism
mcf00520  Amino sugar and nucleotide sugar metabolism
mcf00524  Neomycin, kanamycin and gentamicin biosynthesis
mcf01100  Metabolic pathways
mcf01200  Carbon metabolism
mcf04066  HIF-1 signaling pathway
mcf04910  Insulin signaling pathway
mcf04930  Type II diabetes mellitus
mcf04973  Carbohydrate digestion and absorption
mcf05230  Central carbon metabolism in cancer
Module
mcf_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mcf_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    102145864 (HK1)
   00051 Fructose and mannose metabolism
    102145864 (HK1)
   00052 Galactose metabolism
    102145864 (HK1)
   00500 Starch and sucrose metabolism
    102145864 (HK1)
   00520 Amino sugar and nucleotide sugar metabolism
    102145864 (HK1)
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    102145864 (HK1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    102145864 (HK1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    102145864 (HK1)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    102145864 (HK1)
 09160 Human Diseases
  09161 Cancers
   05230 Central carbon metabolism in cancer
    102145864 (HK1)
  09166 Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    102145864 (HK1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcf04131]
    102145864 (HK1)
Enzymes [BR:mcf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     102145864 (HK1)
Membrane trafficking [BR:mcf04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    102145864 (HK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 CSD
Motif
Other DBs
NCBI-GeneID: 102145864
NCBI-ProteinID: XP_005565727
UniProt: A0A2K5TME6
LinkDB All DBs
Position
9
AA seq 921 aa AA seqDB search
MGQICQRESATAAKKLKSHPLDESEIDKYLYAMRLSDETLIDIMTRFKKEMKNGLSRDFN
PTATVKMLPTFVRSIPDGSEKGDFIALDLGGSSFRILRVQVNHEKNQNVHMESEVYDTPE
NIVHGSGSQLFDHVAECLGDFMEKRKIKDKKLPVGFTFSFPCQQSKIDEAILITWTKRFK
ASGVEGADVVKLLNKAIKKRGDYDANIVAVVNDTVGTMMTCGYDDQQCEVGLIIGTGTNA
CYMEELRHIDLVEGDEGRMCINTEWGAFGDDGSLEDIRTEFDREIDRGSLNPGKQLFEKM
VSGMYLGELVRLILVKMAKEGLLFEGRITPELLTRGKFNTSDVSAIEKNKEGLHNAKEIL
TRLGVEPSDDDCVSVQHVCTIVSFRSANLVAATLGAILNRLRDNKGTPRLRTTVGVDGSL
YKTHPQYSRRFHKTLRRLVPDSDVRFLLSESGSGKGAAMVTAVAYRLAEQHRQIEETLAH
FHLTKDMLLEVKKRMRAEMELGLRKQTHNNAVVKMLPSFVRSTPDGTENGDFLALDLGGT
NFRVLLVKIRSGKKRTVEMHNKIYAIPIEIMQGTGEELFDHIVSCISDFLDYMGIKGPRM
PLGFTFSFPCQQTSLDAGILITWTKGFKATDCVGHDVATLLRDAIKRREEFDLDVVAVVN
DTVGTMMTCAYEEPTCEVGLIVGTGSNACYMEEMKNVEMVEGDRGLMCINMEWGAFGDNG
RLDDIRTQYDRLVDEYSLNAGKQRYEKMISGMYLGEIVRNILIDFTKKGFLFRGQISEPL
KTRGIFETKFLSQIESDRLALLQVRAILQQLGLNSTCDDSILVKTVCGVVSRRAAQLCGA
GMAAVVDKIRENRGLDRLNVTVGVDGTLYKLHPHFSRIMHQTVKELSPKCNVSFLLSEDG
SGKGAALITAVGVRLRTEASS
NT seq 2766 nt NT seq  +upstreamnt  +downstreamnt
atggggcagatctgccagcgagaatcggctacagcagctaaaaaactaaaatctcatcca
cttgatgaaagtgagattgacaagtatctctatgccatgcggctgtccgatgaaactctc
atagatatcatgactcgcttcaagaaggaaatgaagaatggcctctcccgggattttaat
ccaacagccacagtcaagatgttgccaacattcgtaagatccattcccgatggctctgaa
aagggagatttcattgccctggatcttggtgggtcttcctttcgaattctgcgggtgcaa
gtgaatcatgagaaaaaccagaatgttcacatggagtccgaggtttatgacaccccagag
aacatcgtgcacggcagtggaagccagctttttgatcatgttgctgagtgcctgggagat
ttcatggagaaaaggaagatcaaggacaaaaagttacctgtgggattcacattttctttt
ccttgccaacaatccaaaatagatgaggccattctgatcacctggacaaagcgatttaaa
gcaagtggagtggaaggagcggatgtggtcaagctgcttaacaaagccatcaaaaagcga
ggggactatgatgccaacatcgtagctgtggtgaatgacacagtgggcaccatgatgacc
tgtggctatgacgaccagcagtgtgaagttggcctgatcatcggtactggcaccaatgct
tgctacatggaggaactgaggcacattgatctggtggaaggagacgaggggaggatgtgt
atcaacacagaatggggagcctttggagatgatggatcattagaagacatccggacagag
tttgaccgggagattgaccggggatccctcaaccctggaaaacagctgtttgagaagatg
gtcagtggcatgtacttgggagagctggttcgactgatcctggtcaagatggccaaggag
ggcctcttgtttgaagggcggatcaccccggagctgctcaccagagggaagtttaacacc
agtgatgtgtcagccattgaaaagaataaggaaggcctccacaatgccaaagaaatcctg
acccgcctgggagtggagccgtccgatgatgactgtgtctcggtccagcacgtttgcacc
attgtctcgtttcgctcagccaacctggtagctgctacactgggcgccatcttgaaccgc
ctgcgtgataacaagggcacacccaggctgcggaccacggttggtgtcgacggatctctt
tacaagacgcacccacagtattcccggcgtttccacaagactctgaggcgcttggtgccg
gactccgatgtgcgtttcctcctctcggagagtggcagcggcaagggggctgccatggtg
acagcggtggcctaccgcttggccgagcagcaccggcaaatagaggagaccctggctcat
ttccacctcaccaaggacatgctgctggaggtgaagaagaggatgcgggccgagatggag
ctggggctgaggaagcagacgcacaacaatgccgtggttaagatgctgccctccttcgtc
cggagtacccctgacgggaccgagaatggtgacttcttggccctggatcttggaggaacc
aatttccgtgtgctgctggtgaaaatccgtagtgggaaaaagagaacggtggaaatgcac
aacaagatctacgccattcctattgaaatcatgcagggcactggggaagagctgtttgat
cacattgtctcctgcatctctgacttcctggactacatggggatcaaaggccctaggatg
cctctgggcttcacgttctcatttccctgccagcagacgagtctggacgcgggaatcttg
atcacgtggacaaagggttttaaggcaacagactgcgtgggccatgatgtagccacctta
ctaagggatgcgataaaaaggagagaggaatttgacctggacgtggtggctgtggtcaac
gacacagtgggcaccatgatgacctgtgcttatgaggagcccacctgtgaggtcggactc
attgttgggactggcagcaatgcctgctacatggaggagatgaagaatgtggagatggtg
gagggagaccgggggctgatgtgcatcaacatggagtggggggcctttggggacaatggg
cgtctggatgatatcaggacacagtacgacagactggtggatgaatattccctaaatgcc
gggaaacaaaggtatgagaagatgatcagtggtatgtacctgggtgaaatcgtccgcaac
atcttaattgacttcaccaagaagggattcctcttccgagggcagatctcagagccgctg
aagacccggggcatctttgagaccaagtttctctctcagatcgaaagtgaccgattagca
ctgctccaggtccgggccatcctccagcagctgggtctgaatagcacctgcgatgacagt
atcctcgtcaagaccgtgtgtggggtggtgtccaggagggccgcgcagctgtgtggcgca
ggcatggctgcggtggtggataagatccgagagaacagaggactggaccgtctgaacgtg
actgtgggagtggacgggacgctctacaagcttcatccgcacttctccagaatcatgcac
cagacggtgaaggaactatcaccaaaatgtaacgtgtccttcctcctgtctgaggatggc
agcggcaagggagccgccctcatcacggccgtgggcgtgcggttacgcacagaggcaagc
agctaa

DBGET integrated database retrieval system