KEGG   Macaca fascicularis (crab-eating macaque): 107130068
Entry
107130068         CDS       T02918                                 

Gene name
IL4, BSF-1
Definition
(RefSeq) interleukin 4
  KO
K05430  interleukin 4
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04060  Cytokine-cytokine receptor interaction
mcf04151  PI3K-Akt signaling pathway
mcf04630  JAK-STAT signaling pathway
mcf04640  Hematopoietic cell lineage
mcf04657  IL-17 signaling pathway
mcf04658  Th1 and Th2 cell differentiation
mcf04659  Th17 cell differentiation
mcf04660  T cell receptor signaling pathway
mcf04664  Fc epsilon RI signaling pathway
mcf04672  Intestinal immune network for IgA production
mcf05140  Leishmaniasis
mcf05200  Pathways in cancer
mcf05310  Asthma
mcf05320  Autoimmune thyroid disease
mcf05321  Inflammatory bowel disease
mcf05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    107130068 (IL4)
   04151 PI3K-Akt signaling pathway
    107130068 (IL4)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107130068 (IL4)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    107130068 (IL4)
   04660 T cell receptor signaling pathway
    107130068 (IL4)
   04658 Th1 and Th2 cell differentiation
    107130068 (IL4)
   04659 Th17 cell differentiation
    107130068 (IL4)
   04657 IL-17 signaling pathway
    107130068 (IL4)
   04664 Fc epsilon RI signaling pathway
    107130068 (IL4)
   04672 Intestinal immune network for IgA production
    107130068 (IL4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107130068 (IL4)
  09163 Immune disease
   05310 Asthma
    107130068 (IL4)
   05320 Autoimmune thyroid disease
    107130068 (IL4)
   05321 Inflammatory bowel disease
    107130068 (IL4)
   05330 Allograft rejection
    107130068 (IL4)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    107130068 (IL4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcf04052]
    107130068 (IL4)
   00536 Glycosaminoglycan binding proteins [BR:mcf00536]
    107130068 (IL4)
Cytokines and growth factors [BR:mcf04052]
 Cytokines
  Interleukins
   107130068 (IL4)
Glycosaminoglycan binding proteins [BR:mcf00536]
 Heparan sulfate / Haparin
  Cytokines
   107130068 (IL4)
SSDB
Motif
Pfam: IL4
Other DBs
NCBI-GeneID: 107130068
NCBI-ProteinID: XP_015307359
LinkDB
Position
6
AA seq 136 aa
MGLTSQLLPPLFFLLACAGNFAHGHNCHIALREIIETLNSLTEQKTLCTKLTITDILAAS
KQHACLPTSRHSGSMCRPPPAPVPSTSTRPQSTERTQLRRKPSAGLRLCSGSSTATMRRT
LAAWVRLHSSSTGTSS
NT seq 411 nt   +upstreamnt  +downstreamnt
atgggtctcacctcccaactgcttccccctctgttcttcctgctagcatgtgccggcaac
tttgcccacggacacaactgccatatcgccttacgggagatcatcgaaactctgaacagc
ctcacagagcagaagactctgtgcaccaagttgaccataacggacatccttgctgcctcc
aagcagcatgcatgtctgcccacctccagacactcaggtagcatgtgccgccccccacca
gcccctgtcccctccacctcgactcgcccacaaagcacagagagaacacaactgagaagg
aaaccttctgcagggctgcgactgtgctccggcagttctacagccaccatgagaaggaca
ctcgctgcctgggtgcgactgcacagcagttccacaggcacaagcagctga

DBGET integrated database retrieval system