KEGG   Methyloceanibacter caenitepidi: GL4_1089Help
Entry
GL4_1089          CDS       T03636                                 

Definition
(GenBank) enoyl-[acyl-carrier-protein] reductase [NADH]
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
mcg  Methyloceanibacter caenitepidi
Pathway
mcg00061  Fatty acid biosynthesis
mcg00780  Biotin metabolism
mcg01100  Metabolic pathways
mcg01130  Biosynthesis of antibiotics
mcg01212  Fatty acid metabolism
Module
mcg_M00083  Fatty acid biosynthesis, elongation
mcg_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:mcg00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    GL4_1089
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    GL4_1089
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    GL4_1089
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:mcg01004]
    GL4_1089
Enzymes [BR:mcg01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     GL4_1089
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     GL4_1089
Lipid biosynthesis proteins [BR:mcg01004]
 Fatty acid synthase
  Component type
   GL4_1089
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Polysacc_synt_2
Motif
Other DBs
NCBI-ProteinID: BAQ16549
UniProt: A0A0A8K3H7
LinkDB All DBs
Position
complement(1121434..1122252)
Genome map
AA seq 272 aa AA seqDB search
MADGGNLMAGKRGIVFGVANNRSIAWGITKAIAGQGAEVALTYQGDALKKRVEPLAAEVG
AKLVLPCDVTDTATMDAVFATVEKEWGSLDFIVHAVAFSDKDQLDGRYVDTTEENFAKTM
NISCFSLTAMAKRAEPLMTNGGSILTLTYYGAEKVMPHYNVMGVAKAALETSVQYLAADL
GKNNIRVNAISAGPIKTLAASGISDFRYILKWNEYNSPLRRTVTIEDVGGGGLYLLSDLS
AGVTGEVLHIDAGYHVVGMKNEDAPDISVVKD
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atggcggacggcggaaatctcatggcgggcaagcgtggcatcgttttcggtgtcgccaac
aatcgctcgatcgcttggggcatcaccaaggcaatcgccggacagggcgccgaagtcgcg
ctgacctaccagggggatgccttgaagaagcgcgtcgagccgctggccgccgaggttggc
gcgaagctcgttcttccctgcgacgttaccgacacggcaacgatggacgccgtcttcgcg
actgtcgagaaggaatggggaagcctcgacttcatcgtccacgctgtcgccttttcggac
aaggaccagctcgacggccgctacgtcgacacgaccgaagaaaacttcgccaagacgatg
aatatctcctgcttctcgctgacggccatggcgaagcgcgccgaaccgctgatgacgaat
ggcggttcgatcttgacgctcacctattacggcgccgagaaggtcatgccccattacaac
gtgatgggcgtcgccaaggccgcgctcgagacgagcgtgcaatatctcgccgctgatctc
ggcaagaacaatatccgcgtgaacgcgatctcggccggcccgatcaagacgctggccgcg
tcgggcatttccgacttccgctatattctgaagtggaacgagtacaactcgccgctgcgc
cggaccgtcaccatcgaagatgtgggcggcggcgggctctatcttctgtccgatctttcc
gccggtgtcacaggtgaagtcctgcatatcgatgcgggctaccacgtggtcggcatgaag
aacgaggacgccccggacatctccgtggtgaaggactag

DBGET integrated database retrieval system