KEGG   Methyloceanibacter caenitepidi: GL4_1580Help
Entry
GL4_1580          CDS       T03636                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
mcg  Methyloceanibacter caenitepidi
Pathway
mcg00473  D-Alanine metabolism
mcg00550  Peptidoglycan biosynthesis
mcg01100  Metabolic pathways
mcg01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:mcg00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    GL4_1580
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    GL4_1580
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    GL4_1580
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:mcg01011]
    GL4_1580
Enzymes [BR:mcg01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     GL4_1580
Peptidoglycan biosynthesis and degradation proteins [BR:mcg01011]
 Precursor biosynthesis
  Amino acid ligase
   GL4_1580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_4 ATP-grasp_3 GARS_A
Motif
Other DBs
NCBI-ProteinID: BAQ17035
UniProt: A0A0A8K292
LinkDB All DBs
Position
1633407..1634342
Genome map
AA seq 311 aa AA seqDB search
MTEEQTHVAVLMGGLSSEREISLRSGTACAKALEGEGYKVTKIDVGRDVAERLAAIKPDV
CFNALHGKYGEDGCIQGVLETMGLPYTHSGVLASALAMHKERAKAVLREAGVPVAESRVV
SRAEAAKGHPIEPPYVIKPPAEGSSVGVYIIREDQAHPPQELTSADWALGEELMVERFIH
GRELTCAVMGDEALDVIEIRPAEGLTFYDYESKYAPGGSIHVLPAPIKLNVYQLVQKLSV
AAHRALGCRGVSRSDFRYDDRPDGTGELICLEVNTQPGMTSTSLVPELAAHKGRSFGELV
RWIVEDASCNR
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaagaacaaacccacgtcgccgtcctgatgggaggcctgtcctcggagcgcgaa
atatcgctcaggtccggcaccgcctgtgccaaggctctcgagggcgaaggctacaaggtc
accaagatcgatgtgggccgggacgtcgccgagcgtttggccgcgatcaagccggacgtc
tgtttcaacgcgctccacggcaaatacggcgaagacggctgcatccagggcgttcttgag
actatggggctgccttacacccattcgggcgttctggcctcggcgctcgccatgcacaag
gaacgtgcgaaggccgtcctccgagaggcgggcgtgccggtagccgaaagccgggtcgtg
agccgggcggaagctgccaaggggcacccgatcgagccgccttacgtgatcaagcccccg
gcagagggctcatccgtcggcgtttacatcatccgtgaagaccaagcgcatccgccgcag
gagctgacatccgccgattgggccctgggcgaggagctgatggtggagcgtttcatccat
ggccgcgagctcacctgcgcggtgatgggggacgaagcgctggacgtgatcgagatccgt
ccggccgagggcctcaccttctacgactacgagtcgaaatacgcccccggagggtcaatt
cacgtcctgccggcgccaattaaactaaatgtttaccaattggtacagaagctgtcggta
gcggctcatagggcactgggctgccgtggggtcagtcggagcgacttccgttacgacgac
cggccggatggaacgggggaactgatctgtcttgaggtcaacacccaaccgggcatgacg
tccacgtcactggtgccggagcttgccgcccataaagggcgatcgtttggtgagctggtc
cgttggatcgtggaggatgcgtcgtgcaatcgctag

DBGET integrated database retrieval system