KEGG   Methyloceanibacter caenitepidi: GL4_2205Help
Entry
GL4_2205          CDS       T03636                                 

Definition
(GenBank) aspartyl-tRNA(Asn) amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
mcg  Methyloceanibacter caenitepidi
Pathway
mcg00970  Aminoacyl-tRNA biosynthesis
mcg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mcg00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    GL4_2205
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:mcg03029]
    GL4_2205
Enzymes [BR:mcg01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     GL4_2205
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     GL4_2205
Mitochondrial biogenesis [BR:mcg03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    GL4_2205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: BAQ17647
UniProt: A0A0A8K527
LinkDB All DBs
Position
complement(2289618..2291090)
Genome map
AA seq 490 aa AA seqDB search
MDAKSDKSNLIAGETGDWEVVIGMEVHAQVTSNAKLFSGASTEFGGEPNSHVSLVDAAMP
GMLPVINETCVAQAIKTGLGLKAEINLYSVFDRKNYFYPDLPQGYQISQYKNPIVGEGEV
IVDMLSGERVIVGIERLHLEQDAGKSLHDQHPQNSYVDLNRSGVALMEIVSKPDIRSSEQ
AKTYVSKLRTILRYLGTCDGNMDQGSLRADVNVSVRRPGDELGTRCEIKNMNSIRFIGQA
IEYEARRQIEIIEDGGTIDQETRLFDAKTGETRSMRSKEEAHDYRYFPDPDLLPLELKQD
FVDEIAASLPELPDEKRARFIAEYGLTPYDADVLVAERESVDYFEDVAKGRDAKQAANWV
INELFGRLNKEGLTINDSPVSSGQLGAIVDLIKDGTISGKIAKDMFDIVWTEGGDPAEIV
EARGMKQVTDTGAIEKAVDEVFAANPDKVEQAKEKPAMAGWFVGQVMKATGGKASPQAVN
ALIKAKLGIE
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atggacgccaaatcggacaaatcgaatttgatcgcaggcgagaccggcgattgggaagtc
gtgatcggcatggaggtccatgcccaggtcacctcgaacgcgaagctgttctcgggcgcc
tcgaccgagttcggcggcgagccgaattcccatgtcagcctcgtggacgcggccatgccc
ggcatgctgcccgtcatcaacgaaacctgcgtggctcaggcgatcaagaccgggctcggg
ctgaaggccgagatcaatctgtactcggtgttcgaccggaagaactatttctatccggat
ctgccgcagggctatcagatcagccagtacaagaacccgatcgtgggcgagggcgaggtc
atcgtcgacatgctcagcggcgagcgggtcattgtcggcatcgagcgcctgcacctggaa
caggacgcgggcaagagcctgcacgatcagcatccgcagaactcctatgtcgacttgaac
cgttccggcgtggcgctgatggagatcgtgtctaagccggacattcgctcttcggagcag
gcgaaaacctatgtgtccaagctgcggacgatcctgcgctatctcggcacgtgtgacggc
aacatggatcagggctcgctgcgtgccgacgtgaacgtctcggtccgccgtccgggcgac
gagcttgggacgcgttgcgagatcaagaacatgaactcgatccggttcatcggccaagcc
atcgagtacgaggcgcgccgccagattgagatcatcgaggacggcggcaccatcgatcag
gagacgcggctgttcgatgcgaagacgggcgagacgcggtccatgcgctcgaaagaagag
gcgcacgactatcgttatttcccggacccggacctgttgccgctcgaactgaagcaggat
ttcgtcgacgagatcgccgccagcctcccggagcttcccgacgagaagcgggcgcggttc
atcgccgagtacgggctgactccctatgacgccgacgtgcttgtggccgagcgtgagagc
gtcgactatttcgaggacgtggcgaaggggcgtgacgccaagcaggctgcgaactgggtt
atcaacgagctgttcggccggctcaacaaggaaggcctcaccatcaatgacagcccggtg
tcctcgggccagctcggcgccatcgtcgatctcatcaaggacggaaccatctccggcaag
atcgccaaggacatgttcgacatcgtgtggaccgaaggcggcgacccggccgagatcgtc
gaggcccgtggcatgaagcaggtcaccgacaccggcgccatcgagaaggcggtcgacgag
gtcttcgcggccaatcccgacaaggtcgagcaggccaaggagaagccggcgatggccggc
tggttcgtcggtcaggtgatgaaggcgacgggcggcaaggccagcccgcaggccgtcaac
gcgctgatcaaggcgaagctcggtatcgagtag

DBGET integrated database retrieval system