KEGG   Methyloceanibacter caenitepidi: GL4_2310Help
Entry
GL4_2310          CDS       T03636                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
mcg  Methyloceanibacter caenitepidi
Brite
KEGG Orthology (KO) [BR:mcg00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:mcg03012]
    GL4_2310
   03029 Mitochondrial biogenesis [BR:mcg03029]
    GL4_2310
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcg04147]
    GL4_2310
Translation factors [BR:mcg03012]
 Eukaryotic Type
  Elongation factors
   GL4_2310
 Prokaryotic Type
   GL4_2310
Mitochondrial biogenesis [BR:mcg03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    GL4_2310
Exosome [BR:mcg04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   GL4_2310
  Exosomal proteins of breast cancer cells
   GL4_2310
  Exosomal proteins of colorectal cancer cells
   GL4_2310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: BAQ17751
UniProt: A0A0A8K4L8
LinkDB All DBs
Position
complement(2383669..2384859)
Genome map
AA seq 396 aa AA seqDB search
MAKEKFDRSKPHCNIGTIGHVDHGKTTLTAAITKTLAETGGAKFTAYDEIDKAPEEKARG
ITISTAHVEYETENRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLARQVGVPALVVFLNKVDQVDDEELLDLVELEVRELLSKYEFPGDDIPIIKGSALAAIE
DSNPEIGQKAIMELMKAVDEYIPQPERPKDQPFLMPIEDVFSISGRGTVVTGRVERGVVK
VGEEVEIVGIKPTTKTTVTGVEMFRKLLDQGEAGDNVGCLLRGVDREGVERGQVLAKPGS
VTPHTKFKAEAYILTKEEGGRHTPFFGNYRPQFYFRTTDVTGVVELPEGTEMVMPGDNIA
MTVELIVPIAMEEKLRFAIREGGRTVGAGVVSSIIE
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggctaaagagaaattcgaccggtcaaagccgcattgcaacatcggtacgattggtcac
gtcgatcacggtaaaacgaccctgaccgctgcgatcaccaagacattggctgagaccggc
ggcgccaagttcaccgcctacgatgaaatcgacaaggcgcctgaagagaaggctcgcggt
atcacgatctccacggcacacgtggagtacgagaccgagaaccggcactacgcccacgtg
gactgcccgggtcacgccgactacgtgaagaacatgatcacgggtgccgcccagatggac
ggcgccattctggtggtgtccgctgccgatggccccatgccgcagacccgcgagcacatc
ctgcttgcccgtcaggttggcgtgccggcgctggtggtgttcctgaacaaggtcgaccag
gtcgacgacgaggagcttctggatctcgttgagctcgaggttcgcgagcttctgtccaag
tacgagttcccgggcgacgatatcccgatcatcaagggctcggctcttgcggcgatcgag
gacagcaacccggagatcggtcagaaggccatcatggagctcatgaaggctgtcgacgag
tacatcccgcagcccgagcgtccgaaggatcagcccttcctgatgccgatcgaagacgtg
ttctcgatctccggccgcggtaccgtcgtgaccggccgtgtcgagcgtggcgtcgtcaag
gttggcgaggaagtcgagattgtcggtatcaagccgaccaccaagacgaccgtcaccggc
gttgagatgttccgcaagctgctcgaccagggcgaggccggcgacaatgtcggttgtctg
ctccgtggtgtggaccgcgaaggtgtcgagcgtggtcaggttctggccaagcccggttct
gtgacgccgcacacgaagttcaaggccgaggcctacatcctcaccaaggaagagggtggc
cgccacacgccgttcttcggcaactaccgtccgcagttctacttccgcacgaccgacgtg
acgggtgtggtggagctgccggaaggcaccgagatggtgatgccgggcgacaacatcgcc
atgaccgttgagctgatcgtgccgatcgccatggaagagaagctccgcttcgctatccgt
gaaggtggccgcaccgtcggcgccggcgtggtgtcgtcgatcatcgagtaa

DBGET integrated database retrieval system