KEGG   Methyloceanibacter caenitepidi: GL4_3188Help
Entry
GL4_3188          CDS       T03636                                 

Definition
(GenBank) glucoamylase
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
mcg  Methyloceanibacter caenitepidi
Pathway
mcg00500  Starch and sucrose metabolism
mcg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mcg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    GL4_3188
Enzymes [BR:mcg01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     GL4_3188
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucodextran_N Glyco_hydro_15 CBM53
Motif
Other DBs
NCBI-ProteinID: BAQ18619
UniProt: A0A0A8K983
LinkDB All DBs
Position
3227856..3230219
Genome map
AA seq 787 aa AA seqDB search
MKAPNGPCRPTWAPARKDIVGRSLGSSRLWYTLAQGIVTELYYPRIDIPQIKDLGFIVAD
GNGFWVELRRNGDYTVELAAPGVPSATVTHRHPRFTFTMEVCPSQQRDVLLIRYKLEGDP
ALKPYVLLAARLGDNAENNVAYVGHHDGRDVLWAEQDRFALALTAVRDDGSDAFGKRSVG
CLGVSDGWQDFNHNGQMGWLYDEAGPGAVSLMGELTPSGTLSLGFGASKEAAATLSASAI
MDNFDEEVRENTLAWQDWLRQRRPATFGGEIDDRLALCATVIKVHQDQTFRGAAIASLSI
PWGDTSTSRGGYHLVWPRDLVETAGALVAMGSFRDAREVLRYLMATQHTDGHWFQNQWLG
GHPFWQGIQLDEAAFPILLAATLESHGALDDIPVRTMIARAAGFICRVGPTTDQDRWEED
SGLNMFTIAVAISALVEASRYLDGAAKAHVLRVADYWNAKLEDWAFVRGTPLADQLGIKG
YFIRTVPLDVLGTPGAANTPVVIKNLSQDPNLPASGQVSTDCLQLVRYGLREANNPFILD
TIKAMDHLLKTDTPAGPVWHRYNNDGYGEHTDGTGFDGTGHGRGWPLLTGERGHYAVSAG
EDVMPYVEAMMAMSNDVGLMPEQVWDTDPIPEYGLYPGKPSGSAMPLVWTHAEFAKLCHS
LTAGRPVDRPQAAWARYQGVRPTIDYEIWGPRHKPTRIGAGRSLYIAVTAPALVHYGTNG
WRDIHDVETEDTLLGVHVAKLPTEALNPGDTVEFTLYWPESGNWEGQDFQITVEGEPAVV
PAHGAVS
NT seq 2364 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcaccaaacggcccttgccgccccacctgggccccggcccgcaaggacatcgtc
ggcaggagcctcggctcgtcccgtctttggtataccctcgcgcaaggcatcgtgacggag
ctctactacccgcgcatcgacattccccagatcaaggatctcggcttcatcgtggccgat
ggcaacggcttctgggtggaactgcgccgcaacggggattacaccgtcgagctcgcggcg
ccgggtgtcccctcggcgaccgtgacccaccgccacccgcggttcactttcaccatggag
gtctgcccctcgcagcagcgcgatgtcctcctcatccgctacaagcttgagggcgacccc
gccttgaagccttacgtgctgttggcggcgcggcttggcgataacgccgagaacaacgtg
gcctatgtgggccaccatgacggccgtgacgtactctgggcggagcaggaccggtttgcg
cttgcgctgacggctgtccgcgacgatggctcggacgccttcggcaaacgctccgtcggc
tgcctcggcgtgagcgacggctggcaggatttcaatcacaacggccagatgggctggctt
tacgacgaggccggaccgggcgcggtctcgctcatgggcgaactgacgccgtcgggcacg
ctgtcgctcggtttcggcgcatcgaaagaagccgccgccacgctctccgcctcggcaatc
atggataattttgacgaggaggtccgggagaacacgctggcctggcaagactggctgcgc
cagcggcggccggcgaccttcggcggcgagatcgacgaccggctcgcgctctgtgcgacc
gtgatcaaggtgcaccaggatcagaccttccgcggcgcggccatcgcctcgctttcgatt
ccgtggggcgacacgagcaccagccgcggcggctaccacctcgtctggccccgtgacctc
gtggagaccgccggcgcgctggtcgccatgggctcgttccgcgacgcgcgcgaagttctg
cgttatctgatggcgacccagcacacggacgggcactggttccagaaccaatggctcggc
ggccatcccttctggcaaggcattcagctcgacgaggcggccttccccatcctgctggcg
gcgacgctcgagagccacggcgccctggacgatatcccggtgcggacgatgatcgcccgc
gccgcgggcttcatctgccgcgtcggccccacgacggatcaggaccgctgggaggaagac
tccggcctcaacatgttcacgatcgcggtggccatctccgcgctcgtcgaggcttcccgc
tatttggacggcgccgccaaggcgcatgtcttgcgggtcgcggactactggaacgccaag
ctcgaggactgggccttcgtacgcggaaccccgctggccgaccagctcggtatcaagggc
tacttcattcggaccgttccgctcgatgtcctcggcacgccgggcgccgccaatacaccg
gtcgtcatcaagaacctgtcgcaggatccgaacctgccggccagcggccaggtgtcgacc
gattgcctgcagctcgtacgctacggtttgcgcgaggcgaacaaccctttcatcctcgat
acgatcaaggcgatggaccatctcctgaagaccgatacgcccgcagggccggtctggcac
cgctacaataatgacggctatggcgaacatacggatggcacgggcttcgacggcaccggg
cacggccgcggctggccgctcctgacgggggagcgcggtcactatgcggtcagcgccggg
gaggatgtcatgccgtatgtcgaggcaatgatggccatgtccaacgacgtcggcctcatg
cccgagcaggtctgggacacggacccgattcccgaatacggcctctatcccggcaagccg
agcggctcggccatgccgcttgtctggactcacgcggaattcgccaagctatgccatagc
ctgactgccggccgccccgtcgaccggccacaggcggcctgggcgcggtatcaaggcgtc
cgtcccacgatcgactatgagatctggggaccgcgccacaagccgacccggatcggcgcg
gggcggtcgctctacatcgccgtgacggcgccggccctcgtccattacggcaccaacggc
tggcgcgatatccacgatgtcgagaccgaggacacgctgctcggcgtccatgtggcgaag
ctgccgacggaggcgctgaaccccggcgatacggtcgagttcaccttgtactggcccgaa
agcgggaactgggaaggtcaggacttccagatcactgtcgaaggcgaacccgccgtggtc
ccggcgcatggagcagtctcctag

DBGET integrated database retrieval system