KEGG   Methylorubrum extorquens CM4: Mchl_0749Help
Entry
Mchl_0749         CDS       T00809                                 

Definition
(GenBank) HemY domain protein
  KO
K02498  HemY protein
Organism
mch  Methylorubrum extorquens CM4
Brite
KEGG Orthology (KO) [BR:mch00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99987 Cofactor metabolism
    Mchl_0749
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HemY_N TPR_19 ANAPC3 ParD_antitoxin TPR_14
Motif
Other DBs
NCBI-ProteinID: ACK81668
UniProt: B7KZD8
LinkDB All DBs
Position
746049..747584
Genome map
AA seq 511 aa AA seqDB search
MWRALVFLALLAVAAYGAVWIADHPGTVTVVWNGYEIGMSLAIALTGVLVAAIVLGLIWA
VVTGVIGLPASISRSTRERRRNKGLASLSRGMIAVGSGDPLAARRHAGDAERLLGSQPLT
LLLKAQAAQISGDRDAAEQAFKRMADDPETRVLGLRGLFVEARRREDEGAARAYASEAAR
LAPSVTWANEAVLEAQCADGEWSAATETVERRAALGLMDKHAARRQRAVLLTAAAQRHEA
GEPDTATEQALKAVKLAPDLVPAAVIAGRLLARRNDLRKAAKIIEAAWKATPHPELAKVY
LNLRTGDSARDRLARAENLAKLSSWEPESRLVIAQAATEAKDFGRAREALAPLTDDRPTA
RVCRMMARIEAAEHGAESGRSREWLARAARAPRDPAWVADGIISERWAPVSPVSGRLDAF
VWKTPPEILAGPEDDDAPVPASAEPSAPVAIPTTPVPARVTTDSPAPSTPGFLQTGAGTP
SVPPTPAPVNGPTGPSSATQAAAADRPRRIA
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgtggcgcgccctcgtcttcctggccctcctggccgtcgccgcctacggcgcggtgtgg
atcgccgaccatccgggcaccgtgaccgtcgtctggaacggctacgagatcggcatgagc
ctcgccatcgccctcaccggtgtgctggtggcggcgattgtcctcggcctgatctgggcg
gtcgtgaccggcgtgatcggcttgcccgccagcatcagccgctcgacccgcgagcgccgc
cgcaacaagggcctcgcctcgctctcgcgcggcatgatcgccgtcggctccggtgacccg
ctcgcggcccgccgccacgcgggcgacgccgagcgcctgctcggcagccagccgctgacg
ctcctcctcaaggcccaggcggcccagatttctggagaccgggacgcggccgaacaggcg
ttcaagcggatggccgacgatcccgagacgcgtgtgctgggtctgcgcggcctgttcgtc
gaggcccgccgccgtgaggacgagggcgccgcccgcgcctacgcctccgaagctgcccgt
ctcgcgccgagcgtcacctgggcgaacgaggcggtgctggaggcgcaatgcgccgacggc
gagtggtccgctgcgaccgagaccgtggagcgccgcgccgctttggggctgatggacaag
cacgccgcccgccgccagcgcgcggtgctgctcacagcagccgcccagcgccacgaggcc
ggcgagcccgataccgcgaccgagcaggcgctcaaggccgtcaagctcgcccccgacctc
gtgccggcggccgtcatcgccggccggctgctcgcccggcgcaacgatctgcgcaaggcc
gccaagatcatcgaagctgcgtggaaggcgaccccgcatccggaactcgccaaggtctac
ctcaacctgcgcacgggcgactccgcccgcgaccggctggctcgcgccgagaatctcgcc
aagctttcgtcctgggagccggaatcgcgtctggtgatcgcccaggccgcgaccgaggcc
aaggatttcggccgcgcccgcgaggcgctggcgccgctcaccgacgaccggccgacggcg
cgcgtctgccggatgatggcgcggatcgaggccgccgagcacggcgccgaaagtggacgc
tcccgcgagtggctcgcccgtgcggcccgcgccccgcgcgacccggcctgggtcgccgac
ggcatcatctccgagcgctgggcgccggtctcgccggtctccggccgcctcgacgccttc
gtgtggaagaccccgcccgagatcctggccggccctgaggacgacgacgctccggtcccg
gcttcggccgaaccctctgctccggtggcgatcccgaccacgcccgtaccggctcgggtc
accacggacagcccggccccgtccacgcccggcttcctccagactggtgcaggcaccccc
tcggtcccgccgacgcccgctccggtcaatggccccaccggcccgtcatcggccacgcaa
gccgccgctgcggaccgtccgcgccgcatcgcctga

DBGET integrated database retrieval system