KEGG   Methylorubrum extorquens CM4: Mchl_1323Help
Entry
Mchl_1323         CDS       T00809                                 

Definition
(GenBank) conserved hypothetical protein
Organism
mch  Methylorubrum extorquens CM4
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ACK82207
UniProt: B7KR02
LinkDB All DBs
Position
1354510..1358916
Genome map
AA seq 1468 aa AA seqDB search
MSTVIPFFRPASARQGNWSQQELAEFYRVEAALLRAGFSIASEHGLSDEGEPWFVFCQPD
GDAIIHFAKIDGNYLIASDALDRPVRGTDFRTLIDQIARLHPHLLPIPATGTGTTLVVHP
AALLAALVAAAALSLSSEDAHAGPLLAGGEGVSPPPTSQGGGPAQGHPQPKANGGSGDRD
TDRKQIEAIILSAMIFAAEAMAIDHRAVSAELDLDFADGVGNASILTAQGEAAPASGTAF
GSGRGSVSAQPAVLTAQGSGANPDARPHPASDTIAAASRVDPSPVARTESPAEAPKSPAS
QNQPLAPKFGSDVALTSTSAEASAAKSSGQQASTSARSESAAPASDEPGSASSDQHAGSA
SALIAEPGSRARSALAASSDSADAGSGPARPAWVNAVTQTATNRVPSPEASRDADDRGDG
RPAEAALGNSPKVDPAGLTNGHVEGVGWDRESPAKAGAETHPTGEQPAPGHSQPEGVSRG
VPAETATGNTPQAERGAESDRQATSVAAAQSPQVEPATGNTPQAGQARPDQSPIDSTGQD
RGAPAMAAVGHSPSAEQAGPGQGQASAQGQDQGAPAAASHEMRAEPTSPTNSQVNTVGPD
RATSPEGASGNNPQTAPAGGGNGQAGGVARQEPAPVQAEAANSPPVESSSRGNAGVAAQD
RGPQAEPATGNNPQTAPAGGGHDQSSVVARQDAAPVQAEAANSPPVEASSRDNAGAAAQE
RSPQAEPATGSNPPSAPAGRGHDQSSVVAGQDAAPAQAEAANSPPVESSSRGSGSAGVAA
QERSPQAEPATGGNPPSAQAGRGHDQSSVVAGQDAVPAQAETRNSPPVEQAGRDNGNTSA
AAQERGPQAEHATGSDPLPAQADRGHDQSSAAAREDAVPAQAETRNSPPVEQTGRDNGNT
SAVAQDRGPQAEPAVAQNPPIGRTGPSEGHAGVSGPGSARAEAVTGDPPASQQVGRPSGQ
ENANDQGSQRPTEAASGNDPQIEPTGSNNGQGHGSNSKAEVIAIHEPGSDAPTAGHGRAP
SDASERGSAAQAEAVLPATEQQADRGQSQNSAPAERNDQQASEAHGPGATDTASSHGKPE
TAGETRSDAAPAPKAHALLDPDSASHGSKTLSATELPGGAHEPTDGAAPGPAAKADRAPA
AADGPGQDLTSSPSEPARGHSIEHGSDQAANAAASEQTNGDVFGTKEHGSTPSDVAVTSP
SNVHAGGAGPQARSAQEESAPHGQSADAEPAVPASAAHDPVLQDRGSDRAEAENPLGHGA
SPASDAQIASPKGEHAQADPDGPHDGAGPVVVRAIPVATPQATVHGVDENDLSGPSGGPD
LTSPSAPVSQEAIAPPHPDRGQVDDSLSVSGRTDREAPGQPAPPVKANEPTQPPVQVEAD
LAGGPMPNGQSGSAASQGASGQAKPGRPSPPPAAIDADGNLVFHTDAPQDPAPSAPPQGP
DEATTHHTVGLIGVTDQTHPVHDMYHHT
NT seq 4407 nt NT seq  +upstreamnt  +downstreamnt
atgagcacggtcattcccttcttccgtccggcatcggcgcggcaaggcaactggtcgcag
caggagctggccgagttctatcgcgtcgaggcggctctcctccgtgccgggttcagcatc
gcgagcgagcacggcctcagcgacgagggtgagccgtggttcgtcttctgccaacctgac
ggcgacgcgatcattcacttcgccaaaatcgacggcaactatctcatcgcctcggacgct
ctggatcggcccgtgcgcggcacggatttccggaccctgatcgaccagatcgctcgactg
catccgcacctgctcccaatcccggcgacagggacggggacgacgctcgtggttcatccg
gccgcgctgctcgcggcactggtggcagcggcggccttgagcctgtcgtcagaggatgcc
catgcgggtccgctcctggcggggggcgaaggtgtatctccgccgccgacctctcaggga
ggcgggcccgcacagggccatccgcagccgaaggccaatggcgggtccggtgatcgggac
accgatcgcaagcagatcgaggccatcatcctctccgcgatgatcttcgcagccgaggcc
atggcgatcgatcaccgcgccgtgagcgcggagctggatctcgacttcgcggacggggtg
ggcaacgcctcgatcctaaccgcgcagggcgaagcggcgccggcgtcgggcaccgcgttc
ggctccggccgcgggagcgtgtcggctcagccggccgttctgacggcgcagggcagcggc
gcgaatccggatgctcgtcctcaccccgcttccgacacgattgcagcagcgagccgggtc
gatccgtctcctgtggcgcggaccgaatctccggctgaagcgccgaagtcaccagcctcg
cagaaccagccgctggcgccgaaatttggcagcgacgtcgcgctgaccagcacatcggcc
gaggcgtccgccgccaaatccagcggccaacaggcgtcgacgtcggctcgcagcgagagc
gcggcgcccgcatcggacgagccggggtcggcctcaagtgatcagcacgccggttcggcc
tcggccttgatcgccgagcccggctctcgcgcccgttctgcacttgccgcatcgtctgac
tcggccgacgccggtagcggacctgcccgaccggcctgggtcaatgccgtgactcagact
gcgacgaaccgggttccgtcccccgaagcctcgcgggatgccgacgatcggggcgacggc
cgacccgcggaggctgcgctcgggaacagtccgaaggtcgatccggcggggcttaccaac
ggtcacgtcgagggcgtgggctgggatcgagaatccccggccaaggctggagccgagacc
catccgacaggggagcagccagcccccggccacagccagcctgagggcgtcagtcgaggc
gttccggccgagacggcgaccgggaataccccgcaggccgagcgtggtgccgagagcgac
aggcaagccaccagcgttgcggcggcccagagcccgcaggttgaacccgcgaccgggaac
acgccgcaggccgggcaggcccgccccgatcaaagtcccatcgacagcaccggccaggac
cgcggcgcgccggcgatggcggccgtcggacacagcccgagcgccgagcaggctggaccc
ggtcagggccaagccagcgcccaaggtcaggatcagggtgcgccggctgcggcctctcat
gaaatgcgggccgaaccaacgagccccacgaacagccaggtgaacaccgtcggtccggac
cgcgctacatcgcctgagggggcgagcggaaacaacccgcagaccgcgccggccggcggg
ggcaatggccaagccggcggcgtcgcccggcaggaacccgcgccggttcaggccgaagct
gcgaatagcccaccggtcgagtcgagcagccgtggcaatgccggtgtcgctgctcaggac
cggggcccgcaggccgagcctgcgacgggaaacaatccgcagaccgcgccggccggcggg
ggccatgaccaatcgagcgttgtcgctcggcaagacgccgcgccggttcaggctgaagct
gcgaatagcccaccggtcgaggcgagtagccgtgacaacgcgggtgccgctgctcaggag
cggagtccgcaggctgagcctgcgaccggaagtaatccgccgagcgcgccggccggccgc
ggccatgaccaatcgagcgttgtcgctgggcaagacgccgcgccggctcaggccgaagct
gcgaatagcccaccggtcgagtcgagtagccgtggtagcggcagcgccggtgtcgctgct
caggagcggagcccgcaggctgagcctgcgacgggaggtaatccgccaagcgcacaggcc
ggccgcggccatgaccaatccagcgttgtcgctgggcaagacgccgtgccggctcaagcc
gagacgaggaacagcccaccggtcgagcaggccggccgtgacaacggcaacacgagcgcc
gctgctcaggagcggggcccgcaggccgagcatgcgacgggaagtgatccgctgcccgcg
caggccgatcgcggccatgaccaatccagcgctgccgctcgggaagacgctgtgccggcg
caggccgagacgaggaacagtccaccggtcgagcagaccggccgtgacaacggcaacacg
agcgccgttgctcaggaccggggcccgcaggctgagcctgcggtcgcacagaacccgccg
attgggcggaccggcccgagtgaaggccatgccggcgtctctggtccgggaagcgcacgg
gccgaggccgtgaccggcgatcctcccgcgagtcaacaggttggtcgccccagcggccag
gagaatgccaacgatcaaggttcgcagcggccgaccgaggcggcgtctggaaacgatccg
cagatcgagccgacgggcagcaacaacggccagggtcatggcagcaactcgaaggccgag
gttatcgcgatccatgagccgggctcagacgcgccgaccgccggccacggtcgggccccg
agcgatgccagcgagcggggatcggccgcacaggccgaggccgttcttcccgcgactgag
cagcaggccgatcgcggccagagtcaaaactcggctccggccgagcggaacgaccagcaa
gcgtccgaagcgcatggtcccggcgcgaccgacacggcttcaagtcacggtaagccggaa
actgccggcgaaacgcgatccgacgcggcaccggccccgaaggctcatgcgctactcgac
cccgattccgcttcccacggatcgaaaacgctcagcgcgaccgagctgccgggcggcgcg
cacgagccgaccgacggagcggctcccgggcctgcagccaaggccgatcgggcgcccgcg
gcggcggatggacctggtcaggatctgacatcgtcgccctccgaacccgcacggggtcat
tcgatcgagcatggctccgatcaggccgcgaacgcggcagcctcggaacagacgaacggg
gacgtgttcggcacgaaggagcacggatccacgccaagcgacgtcgccgtgacgtcgcca
tcgaacgtccatgccggcggcgccgggccccaggcgaggtctgcgcaggaagagtcggcg
ccgcacgggcaaagtgccgatgcggagcctgccgttcccgcgtcggctgcccacgatccc
gtcttgcaggatcggggaagcgatcgggcggaggcggaaaaccccctcggacacggagct
tcaccggcgtcggacgctcagattgcgtcgccgaagggtgagcacgcccaagccgatcct
gacgggccgcatgacggcgcgggacccgtcgtcgttcgcgcgatcccagtggcaaccccg
caagcgacggttcacggcgtggacgagaatgacctgtccggcccgtccggaggccctgac
ctgacgtcgccgtctgcaccggtttcgcaggaggcgatcgcaccgccccatcccgatcgg
ggacaggtcgatgacagcctttcggtcagcggccgcaccgaccgggaggcgcccggacag
ccggcccctccggtcaaggccaacgagccgacccagccgcctgtacaggtcgaagccgat
ctggcgggtgggcctatgccaaacggccaatccggctccgcggcgtcccagggggcgtcc
ggccaagcgaagccgggccggccaagccctccgcccgcggcgatcgacgcggacggcaat
ctcgtgttccacacggacgcccctcaggatccggcgccatcggcccctccgcaggggccg
gacgaggcgacgacccatcacacggtcggcctgatcggggtcacggatcagacgcatccg
gtgcacgacatgtatcaccacacctag

DBGET integrated database retrieval system