KEGG   Methylorubrum extorquens CM4: Mchl_1567Help
Entry
Mchl_1567         CDS       T00809                                 

Definition
(GenBank) cellulose synthase catalytic subunit (UDP-forming)
  KO
K00694  cellulose synthase (UDP-forming) [EC:2.4.1.12]
Organism
mch  Methylorubrum extorquens CM4
Pathway
mch00500  Starch and sucrose metabolism
mch01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mch00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Mchl_1567
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:mch01003]
    Mchl_1567
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mch02000]
    Mchl_1567
Enzymes [BR:mch01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.12  cellulose synthase (UDP-forming)
     Mchl_1567
Glycosyltransferases [BR:mch01003]
 Polysaccharide
  Structural polysaccharide
   Mchl_1567
Transporters [BR:mch02000]
 Other Transporters
  Others
   Mchl_1567
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_2 Glyco_tranf_2_3 Glyco_trans_2_3 Glyco_transf_21 Cellulose_synt
Motif
Other DBs
NCBI-ProteinID: ACK82432
UniProt: B7KST0
LinkDB All DBs
Position
1625197..1627701
Genome map
AA seq 834 aa AA seqDB search
MASVIRALRWLAWMGTTVAGLILLSQPVGTQNQLAMSLAAMAAMIVLWLFLDGPRTRFVF
LALGSLVVLRYILWRVTDTLPSPGDPVSFGFGLLLLVGELYCVFILFVSLIINADPLKRA
PPPVARAAELPTVDVFVPSYNEDAAILAMTLAAARQMNYPPDKLTVWLLDDGGSDQKCAD
SNPEKAKAARDRRRELTVLAEELGCRYLTRARNEHAKAGNLNNGLAFASGEIVVVLDADH
VPFRSFLSETVGYFAEDPKLFLVQTPHAFLNPDPIERNLKTFERMPSENEMFYAVTQRGL
DKWNGSFFCGSAALLRRTALDEAGGFSGITITEDCETAFELHSRGWTSAYVDKPLIAGLQ
PETLSAFIGQRSRWCQGMFQILLLKNPALQKGLKPIQKIAYLSSMTFWFFPVPRLIFMFA
PLLHIFFDLKIFVASVDESIAYTATYIVINLMMQNYVYGKFRWPFVSELYEYVQGLYLSK
AIVSVIWSPRKPTFNVTDKGISLDHDHLSSASLPFFAVYGLLAAGCAVATWRYLFEPGVT
NLMLVVGLWNFFNLLTAGAALGVCAERRQLERTPSLAINRRGQITLGGRAIDVSIERVSA
EACTVRLPAALLPTGGGHRKLTGALTVVPVAGARPAGALPVTLERIDRTKDEAFARLSFG
RLRPQDYVALAGLMYGDAEAMRRFQMRRRRHKDILTGTLQFIWWGLSEPFRAVRYAFAAD
ARPAVAPLIDGTSPIYDAPEQAPTGANLPEPLLAPAVPAHAFQAAPQAPRAPVPAEARSP
IPAARAPANPSANPSAAPSANPPARASNDWVRMMLDYENERALAGRTGRGTGTA
NT seq 2505 nt NT seq  +upstreamnt  +downstreamnt
gtggcgagtgtgatacgtgcgctgcggtggctggcctggatggggacgacggttgccggc
ctcatcctgctgagccaaccggtcgggacgcagaaccagctcgccatgagtcttgccgcc
atggcggcgatgatcgtgctgtggctgttcctcgacgggccgcgcacccgcttcgtgttc
ctggcgctcgggagcctcgtggtgctccgctacatcctgtggcgggtcaccgatacgctg
ccctcccccggcgatccggtcagcttcggcttcggcctgctgctgctcgtgggcgaattg
tactgcgtcttcatcctgttcgtgagcctgatcatcaacgccgacccgctcaagcgggcg
ccgccgcctgtcgcgcgcgcggccgagctgccgacggtcgacgtgttcgtgccgagctac
aacgaggacgccgccatcctggcgatgacgctggcagccgcgcgccagatgaactacccg
cccgacaagctcacggtctggcttctcgacgacggcgggtcggaccagaaatgcgccgac
tccaaccccgagaaggccaaggccgcccgcgaccggcggcgcgagctgacggtgctggcc
gaggaactcggctgccgctacctcacccgcgcccgcaacgagcacgccaaggcgggcaac
ctcaacaacgggctggccttcgccagcggtgagatcgtcgtcgtgctcgatgccgaccac
gtcccgttccgctcgttcttgagcgagacggtcggctacttcgccgaagacccgaagctg
ttcctcgtccagaccccgcacgccttcctcaaccccgatccgatcgagcggaacctgaag
accttcgagcggatgccgtcggagaacgagatgttctacgcggtgacgcagcgcgggctc
gacaagtggaacggctcgttcttctgcggctcggccgccttgctgcgacgcaccgccctc
gacgaggccgggggcttctccggcatcaccatcaccgaggattgcgagaccgcgttcgag
ctgcattcccgcggctggaccagcgcctatgtcgacaagcccctgatcgccggtctccaa
cccgagacgctctcggccttcatcggccagcgctcgcgctggtgccagggcatgttccag
atcctgctcctgaagaaccccgctttgcagaaggggctcaagccgatccagaagatcgcc
tacctctcgagcatgacgttctggttcttccccgtgccgcggctgatcttcatgttcgcg
ccgctgctgcacatcttcttcgacctgaagatcttcgtcgccagcgtcgatgaatcgatt
gcctatacggcaacctacatcgtcatcaacctgatgatgcagaactacgtctacggcaag
ttccgctggcccttcgtctcggaactctacgaatacgtccagggcctctatctgtcgaag
gccatcgtctcggtgatctggtcgccgcgaaagccgaccttcaacgtcaccgacaagggc
atcagcctcgaccacgaccatctctcgtcggcctcgctcccgttcttcgccgtttacggg
ctgctggcggcgggctgcgcggtggcgacgtggcgctacctgttcgagccgggcgtgacc
aacctgatgctggtggtcgggctgtggaacttcttcaacctgctgaccgcgggcgcggcg
ctcggggtctgcgccgagcgccgacagctggagcggacgccctcgctcgccatcaaccgg
cgcggccagatcaccttgggcggccgggccatcgacgtgtcgatcgagcgcgtctcggcc
gaggcctgcaccgtgcgcctgcccgccgccctgctgccgacggggggcggacaccgcaag
ctgaccggcgcgctcaccgtcgtcccggtggcgggcgcgcgcccggccggcgccctgccg
gtgaccctggagcggatcgaccgcaccaaggacgaggccttcgcccgcctgagcttcggc
cgcctgcgcccgcaggattacgtggcgctcgccggcctgatgtacggcgacgcggaggcg
atgcgccgcttccagatgcgccgccgccgccacaaggacatcctgaccggcacgctgcaa
ttcatctggtggggtctgtccgagccgttccgcgccgtgcgctacgccttcgccgccgat
gcgcggccggcggtggcgccgctgatcgacggcacctcgccgatctacgatgcgccggaa
caggcgccgaccggggcgaacctgcccgagccgttgcttgcgccagcggtgccggcccac
gcgttccaggccgccccgcaggcgccgagggcgcctgtgccggccgaggcgcggagccca
atcccggcggctcgagccccggccaacccctctgccaacccttcggccgccccttccgcc
aacccgccggcccgcgcctcgaacgattgggtgcgcatgatgctcgactacgagaacgag
cgcgcgctcgccggtcggaccggccgcggcacgggcacggcatga

DBGET integrated database retrieval system