KEGG   Methylorubrum extorquens CM4: Mchl_1840Help
Entry
Mchl_1840         CDS       T00809                                 

Definition
(GenBank) MltA domain protein
  KO
K08304  membrane-bound lytic murein transglycosylase A [EC:4.2.2.-]
Organism
mch  Methylorubrum extorquens CM4
Brite
KEGG Orthology (KO) [BR:mch00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:mch01011]
    Mchl_1840
Enzymes [BR:mch01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.2  Acting on polysaccharides
    4.2.2.-  
     Mchl_1840
Peptidoglycan biosynthesis and degradation proteins [BR:mch01011]
 Peptidoglycan biosynthesis and degradation
  Lytic transglycosylase
   Mchl_1840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MltA 3D DUF4880
Motif
Other DBs
NCBI-ProteinID: ACK82703
UniProt: B7KV32
LinkDB All DBs
Position
1894661..1895917
Genome map
AA seq 418 aa AA seqDB search
MPCLRVSLPAAAVLAAAAVSILAVPSRAAEASRVPPQVAGAVLEPVSLAALPGWREDDGA
ASLDAFRRTCAGPGPNPPQIEGVTGSPADLAAACAAAAEVKPNEAKKFFEARFSAYRIVR
PASGTEPERRVGFLTGYFEPELTGSLEPGPGYTAPVLARPDDLVSLAPGETAPGLDPLYR
AGRRTETGLVPYPDRAAIEDGALGERTRPLLWLRDAVDLFVLQVQGSGRVRLPDGRGMRV
LYDGKNGQPYTSIGKLIVNEGHLPINGLSLERWTAWLRANPDHARRLMRMNASYIFFRTE
PVTDPALGPPGAAGVPLSPGRSMAVDGNLWRYGLPFWLEGKLPGQPGRGHLVVAADTGSA
IVGPARGDLYVGTGAAAGRAAGDLHDRMGFVVLIPKPAPDGAAKGAAAPEAAAGEARP
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgccgtgtttgcgcgtttcccttccggccgcagcggtcctcgccgctgcggccgtttcc
attctcgccgtaccctcgcgcgcggcggaggcttcgcgcgtgccgccccaggtggccggc
gcggtgctggagccggtctccctcgccgccctgcccggctggcgcgaggatgacggggcg
gcctccctcgacgccttccgccgcacctgcgccgggcccggccccaatccgccccagatc
gagggcgtgacgggctcgcccgccgacctcgcggcagcctgcgccgccgccgccgaggtg
aagccgaatgaggccaagaaattcttcgaggcgcggttctccgcctaccgcatcgtccgc
ccggcctccggaacggagcccgagcgtcgggtcggcttcctcacgggctatttcgagccg
gaactcaccggctcgctcgagcccggccccggctataccgcacccgtgctggctcggccg
gacgacctcgtcagcctcgcccccggcgagacggcgccggggctcgatccgctctaccgg
gcgggccggcgcaccgagaccgggctcgttccctatcccgaccgcgcggcgatcgaggat
ggggcgctcggcgagcggacccggccgctgctgtggctgcgcgacgccgtggacctcttc
gtgctgcaggtgcaggggtccgggcgggtgcgcctgcccgatgggcgcgggatgcgggtg
ctctatgacggcaagaacggccagccctacacctcgatcggcaagctgatcgtcaacgag
ggccatctgccgatcaacgggctgagcctggagcgctggacggcgtggctgcgggccaac
cccgaccatgcccgccggctgatgcggatgaacgcgtcctacatcttcttccggaccgag
ccggtgaccgaccccgccctggggccacccggcgccgcgggcgtgccgctgagtccgggg
cgcagcatggccgtcgatgggaacctctggcgctatggtctgccgttctggctggaaggc
aagctgccgggccagcccggccgcggccatctggtcgtcgccgccgataccggttcggcc
atcgtcggcccggcgcgcggcgacctctatgtcggcaccggcgctgccgccggccgagcc
gcgggcgacctgcacgaccggatgggcttcgtggtgctgatcccgaagcccgccccggat
ggtgccgccaagggcgcggcggcaccggaggccgctgccggagaggcgcggccgtga

DBGET integrated database retrieval system