KEGG   Methylorubrum extorquens CM4: Mchl_2110Help
Entry
Mchl_2110         CDS       T00809                                 

Definition
(GenBank) rhodanese
Organism
mch  Methylorubrum extorquens CM4
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rhodanese
Motif
Other DBs
NCBI-ProteinID: ACK82957
UniProt: B7KWZ0
LinkDB All DBs
Position
complement(2206354..2206941)
Genome map
AA seq 195 aa AA seqDB search
MRVIARHAAFAALGLMLGAAGPADSPVNVPEPEGLYTGPPKGYTPATLKGATVIDLKGLE
KLLPEGPVLIDVVLADRRPEGLPADRPWLPTHRSLPGAVWMPGAGGAPLAPEKEEAFLRR
VAELTGGDRAKPVVTFCRPECWGSWNAGKRLVAAGYSRVHWFPPGVEGWQDDHDTAVAKP
DPAWTHADSARVPQR
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgcgggtgatcgcgagacatgcggcattcgccgccctcggcctgatgctgggcgcggcc
ggtccggccgactcgccggtcaacgtgccggagccggaggggctctataccgggccgccg
aagggctacaccccggcgacgctcaagggggcgacggtcatcgacctcaaggggctcgaa
aagctgctcccggaggggccggtcctcatcgacgtggtgctggccgaccgccggcccgag
ggcctgccggccgaccggccctggctgccgacgcaccgctcgctccccggcgcggtctgg
atgccgggcgcgggcggcgcaccgctggcgccggagaaggaggaggccttcctgcggcgg
gtcgccgagctgaccggcggcgaccgggccaagcccgtcgtgaccttctgccggccggaa
tgctgggggagctggaacgccggcaagcggctggtcgcggccggctacagccgcgtccac
tggttcccccccggcgtcgagggttggcaggacgatcacgacaccgccgtcgccaagccc
gatccggcctggacgcacgcggacagcgcgcgcgtgccccagcgctga

DBGET integrated database retrieval system