KEGG   Methylorubrum extorquens CM4: Mchl_2657Help
Entry
Mchl_2657         CDS       T00809                                 

Definition
(GenBank) ribonuclease R
  KO
K12573  ribonuclease R [EC:3.1.13.1]
Organism
mch  Methylorubrum extorquens CM4
Pathway
mch03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:mch00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    Mchl_2657
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mch03019]
    Mchl_2657
   03016 Transfer RNA biogenesis [BR:mch03016]
    Mchl_2657
Enzymes [BR:mch01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.13  Exoribonucleases producing 5'-phosphomonoesters
    3.1.13.1  exoribonuclease II
     Mchl_2657
Messenger RNA biogenesis [BR:mch03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Ribonucreases
     Mchl_2657
Transfer RNA biogenesis [BR:mch03016]
 Prokaryotic type
  tRNA degradation factors
   Mchl_2657
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNB CSD2 S1 OB_RNB RNase_II_C_S1 FaeA
Motif
Other DBs
NCBI-ProteinID: ACK83497
UniProt: B7KNQ8
LinkDB All DBs
Position
2791950..2794316
Genome map
AA seq 788 aa AA seqDB search
MARRINPTAGTPVLPSREQILAFVAETPGKVGKREIAKAFGISGADKIGLKAILKEIEAE
GALERDRGGLRKGGSLPPVVLADIVSRDRDGDLIARPAQWDGEGEAPKIAVETPRAGRKG
NRPAPGIGDRALVRVAPDPEAPGRYSGRVIKVIGKNRSEVIGVYRAGRDGGRLLPVEKKS
QGKEIAIPPGEEGEARDGDLVSVAVERETRFGLPRGRVTERLGALGSEKAVSLIALHIHN
IPHVFPAAVLAEADAAKRATKRGREDWREAPLVTIDPPDAKDHDDAVMAEADPDPANAGG
FILTVAIADVAAYIRPDSALDREALLRGNSVYFPDRVVPMLPERISNDLCSLREGEDRPA
LAVRMIIGADGVKRSHSFHRILMRSHAKLAYAQAQAAIDGRPDEKSRPVLETALRPLYAA
YEAMKRARDARGPLALDLPERKVLLDAEGGVDRVIVPERLEAHRLIEEFMIQANVAAAET
LEKAGSPLIYRVHDEPALEKMRALGEVLASVGVKMTKAGALRPDLFNRILAQVAESEHAP
FINEVVLRSQAQAIYAAQNLGHFGLNLRRYAHFTSPIRRYADLIVHRALVRACGLGKDGL
PDDTTPGMLDAVSEQISAAERRAMAAERETIDRLIAGYLADRVGATFTGRISGVTRSGLF
VKLAETGADGFVPVSTIGHEYYRHDEALHALVGDRSGETYRLGDTVEVRLVEAAAVAGAL
RFEILSEGRSRSGAKGGGFKRSGSKASPGKAKLGKAKFGAKSPKGKPRPGKTAASESDAA
RRHRGSRR
NT seq 2367 nt NT seq  +upstreamnt  +downstreamnt
ttggccagacgcatcaatccgacggcgggcacccccgttctcccctcccgcgagcagatc
ctcgccttcgtcgccgagacgcccggaaaggtcggtaagcgcgaaatcgccaaggccttc
ggcatctccggcgccgacaagatcggcctcaaggcgatcctgaaggagatcgaggccgag
ggcgcgctcgagcgcgaccgcggcggtttgcggaaaggcggcagcctgccgccggtcgtg
ctcgccgacatcgtgtcgcgcgatcgcgacggcgacctgatcgcccgcccggcgcagtgg
gacggggagggcgaggcgcccaagatcgccgtcgagaccccgcgtgccggccgcaagggc
aaccgccccgcccccggcatcggcgaccgggcgctggtccgcgtcgcacccgacccggaa
gcgcccggccgctacagcggccgcgtcatcaaggtgatcggcaagaaccgctccgaagtg
atcggcgtctatcgcgccggccgcgacggcgggcgcctgcttcctgtcgagaagaaatcg
cagggtaaggaaatcgcgatcccgccgggcgaggagggcgaggcccgggatggcgacctc
gtcagcgtcgcggtggagcgcgagacccgcttcggcctgccccgcgggcgcgtcaccgag
cggctcggcgcgctcggctccgagaaggcggtgagcctgatcgcgctgcacatccacaat
atcccgcacgtcttccccgccgccgtgctggcggaggcagacgcggccaagcgcgcgacc
aagcgcggccgcgaggattggcgcgaggcgccgctggtcaccatcgacccgcccgacgcc
aaggaccacgacgacgcggtgatggctgaggccgatcccgatccggccaatgcgggcggc
ttcatcctcaccgtcgcgatcgcggatgtggccgcctatatccggccggattcagccctc
gaccgcgaggcgctgctgcggggcaactcggtctacttccccgaccgggtggtaccgatg
ctgcccgagcgcatttcgaacgatctctgctcgctgcgcgaaggggaggaccgcccggcg
ctcgccgtgcggatgatcatcggcgccgacggggtgaagcgcagccacagcttccaccgc
atcctgatgcgctcgcacgccaagctcgcctatgcgcaggcgcaggccgcgatcgacggc
cggccggacgagaaatcgcgaccggtgctggagaccgcgctccgcccgctctacgcggcc
tacgaggcgatgaagcgggcccgcgatgcccgcggcccgctcgccctcgatctgccggag
cgcaaggtgctgctcgacgcggagggcggcgtcgatcgggtgatcgtgccggagcgtctg
gaggcgcatcggctgatcgaggagttcatgatccaggccaacgtcgcggcggccgagacc
ctcgagaaggcgggctcgccgctgatttaccgggttcacgatgagccggccctggagaag
atgcgcgcgctcggcgaggtgctcgcctcggtcggcgtcaagatgaccaaggccggggcg
ctgcggccggacctgttcaatcgcatcctcgcccaggtggccgagagtgagcacgctccg
ttcatcaacgaagtcgtgctgcgttcgcaggcacaggcgatctacgctgcacagaattta
ggccatttcggcctcaacctgcgccgctacgcccacttcacctcgcctatccgccgctac
gcggatctcatcgtccaccgtgctctcgtgcgtgcctgcggattgggcaaggatggcctg
ccggacgacactacgccgggtatgctcgacgcggtctccgagcagatctcggcggccgag
cgccgggcgatggcggccgagcgcgagaccatcgaccggctcatcgccggctacctcgcc
gaccgggtcggcgcgactttcaccggccggatctccggggtgacgcgctcggggctgttc
gtgaagctcgccgagaccggggccgacgggttcgtgcccgtctccaccatcggccacgaa
tattaccgccacgacgaggccctgcacgcgctcgtcggcgaccgcagcggcgagacctac
cgcctcggcgacacggtcgaggtccgcctcgtcgaggcggcggcggtggccggcgctctg
cgcttcgagattctttcggaggggcgcagccgttccggcgccaaaggcggcgggttcaag
cgcagcgggtccaaggcgagtccgggcaaggcgaagttgggcaaggccaagttcggtgca
aagtcgcccaagggcaagccgcgccccggcaagacggcggcgtccgagagcgatgcggcg
cggcgccatcgcggctcgcgtcgctga

DBGET integrated database retrieval system