KEGG   Methylobacterium extorquens CM4: Mchl_3561Help
Entry
Mchl_3561         CDS       T00809                                 

Definition
(GenBank) ATP dependent DNA ligase
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
mch  Methylobacterium extorquens CM4
Pathway
mch03030  DNA replication
mch03410  Base excision repair
mch03420  Nucleotide excision repair
mch03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:mch00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Mchl_3561
   03410 Base excision repair
    Mchl_3561
   03420 Nucleotide excision repair
    Mchl_3561
   03430 Mismatch repair
    Mchl_3561
Enzymes [BR:mch01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Mchl_3561
    6.5.1.6  DNA ligase (ATP or NAD+)
     Mchl_3561
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     Mchl_3561
DNA replication proteins [BR:mch03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    Mchl_3561
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     Mchl_3561
DNA repair and recombination proteins [BR:mch03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     Mchl_3561
   NER (nucleotide excision repair)
    Other NER factors
     Mchl_3561
   MMR (mismatch exicision repair)
    Other MMR factors
     Mchl_3561
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C
Motif
Other DBs
NCBI-ProteinID: ACK84381
UniProt: B7KVH3
LinkDB All DBs
Position
3747793..3749637
Genome map
AA seq 614 aa AA seqDB search
MNDFAHLLDRLAYEPRRNAKLRLLQDFFAGTPDPERGWALAAMTGGLTFREAKPALIRGL
VEERVDPVLFSLSHNYVGDLAETTALIWPGPEENPFPRMRGEGALKDEALPESPPHRGLP
ARSAGDEVGRALSPQAGRGDPPGPGHNNPPPSVPTLAEVVETLASTPKRELPQHLAHWLD
ALDETGRWALLKLVTGNLRVGVSARLAKTAVGALGGHEADAVEEVWHGLKPPYTELFAWV
EGRGERPESRNPAPFRPPMLSHPVEEFEDLDKLEPEAFSAEWKWDGIRVQLAGGRDSQGR
QVQKVYSRTGEDISDAFPDLAEAITFDGAIDGELLILREGRVQSFNVLQQRLNRKAVTGK
LLEEFPAHVRAYDVLAAEGEDLRPLPFAERRPRLETLVRRLDHARIDLSPLVPFATWDEV
AAARADPASAGAGADADAIEGVMLKRLNSPYLPGRPKGPWWKWKREPYVVDAVMMYAQRG
HGKRSSFYSDYTFGCWREGAEGEELVPVGKAYHGFTDAELQKLDRYVRNHTTKRFGPVRE
VAYGREAGLVLEIAFEGVQRSTRHKSGVAMRFPRVSRIRWDKPAAEADRVDVLERILARG
EREVAPGAAMEASE
NT seq 1845 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgacttcgcccaccttctcgaccgcctcgcctacgaaccgcgccgcaacgccaag
ctgcgcctgctccaggatttcttcgccggcacccccgacccggagcgcggctgggcactc
gccgccatgaccggcggcctcaccttccgcgaggccaagccggcgctgatccgcgggttg
gtggaagagcgggtcgatccggtgctgttttcgctctcgcacaactatgtcggcgatctc
gccgagacgacggcgctgatctggccggggccggaggagaacccctttccccgcatgcgg
ggagaaggtgccttgaaggatgaggctcttccggaatcgccccctcaccgtggcctgccg
gctcgctctgccggcgacgaggtcggcagagccctctccccgcaagcggggagaggggat
ccccccggtccgggccacaacaacccgccgccctccgtccccaccctcgccgaagtcgtc
gaaacactcgcctccaccccgaagcgcgaactgccccagcatctcgcccattggctcgat
gccctcgacgagaccgggcgctgggcgctcctcaagctcgtcaccgggaacctgcgcgtt
ggcgtctcggcccgtctggcgaagacggcggtcggcgcgctcggcggccacgaggcggat
gcggtcgaggaagtctggcacgggctgaaaccgccctataccgagctgttcgcctgggtg
gagggacggggcgagcggccggagagccgcaacccggccccgttccggccgccgatgctc
tcgcacccggtggaggagttcgaagacctcgacaagctcgaaccggaggcgttctcggcg
gagtggaaatgggacggcatccgcgtccagctcgcgggcgggcgcgatagccagggccgg
caggtccaaaaggtctactcgcgcaccggtgaggacatctccgacgcgttccccgacctc
gccgaggcgatcaccttcgacggcgcgatcgacggcgaattgctgatcctgcgcgagggg
cgggtccagagcttcaacgtgctccagcagcggctcaaccggaaggcggtgacgggcaag
ctcctggaggagttcccggcccatgtccgcgcctacgacgtgctggcggccgagggcgag
gacttgcgcccgctgcccttcgccgagcgccgtccccggctggagaccttggtgcggcgg
ctcgaccatgcccggatcgatctctcgccgctcgtccccttcgccacctgggacgaggtg
gccgccgcccgcgccgacccggcctcggcgggggccggcgcggatgccgacgccatcgag
ggcgtgatgctcaagcggctcaacagcccctacctgccgggccgccccaagggcccgtgg
tggaagtggaagcgcgagccctacgtggtcgatgccgtgatgatgtacgcccagcgcggc
cacgggaagcgctcgtccttctactcggactacaccttcggctgctggcgcgagggggcg
gaaggcgaggagctggtgccggtcggcaaggcctatcacggcttcaccgacgccgagttg
cagaagctcgaccgctacgttcgcaaccatacgaccaagcgcttcggcccggtgcgcgag
gtcgcctatggccgcgaggccgggctggtgctggagatcgccttcgagggcgtgcagcgc
tcgacccggcataaatcgggcgtggcgatgcgcttcccccgcgtcagccgcatccgctgg
gacaagccggccgcggaggccgaccgggtcgatgtgctggagcggattctggcgcgcggc
gagcgcgaggtcgcgccgggcgcggcgatggaggcatcggaatga

DBGET integrated database retrieval system