KEGG   Methylorubrum extorquens CM4: Mchl_3732Help
Entry
Mchl_3732         CDS       T00809                                 

Definition
(GenBank) Aldehyde Dehydrogenase
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
mch  Methylorubrum extorquens CM4
Pathway
mch00010  Glycolysis / Gluconeogenesis
mch00620  Pyruvate metabolism
mch01100  Metabolic pathways
mch01110  Biosynthesis of secondary metabolites
mch01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mch00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mchl_3732
   00620 Pyruvate metabolism
    Mchl_3732
Enzymes [BR:mch01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     Mchl_3732
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh OmdA
Motif
Other DBs
NCBI-ProteinID: ACK84551
UniProt: B7KX26
LinkDB All DBs
Position
3939677..3941200
Genome map
AA seq 507 aa AA seqDB search
MNKPEFLADAKTKSPFSARYDNFIGGQWVAPASGRYFENTSPITGKVICEVARSEAADIE
RALDAAHAAKDAWGRTAPAERARILNKIADRMEDNLDLIALAETWDNGKPIRETTAADIP
LAIDHWRYFASCVRAQEGAISEIDHDTVAYHFHEPLGVVGQIIPWNFPILMAVWKLAPAI
AAGNCVVLKPAEQTPASILVVMELIGDLLPPGVINVVNGFGLEAGKPLASNPRIAKIAFT
GETTTGRLIMQYASQNLIPVTLELGGKSPNIFFGDVIDEDDDFFDKALEGFTMFALNQGE
VCTCPSRALVHESIYDRFIERAIKRVEAITQGSPLDPATMIGAQASSEQLEKILSYVDIG
RQEGAECLTGGARGTREGDLADGFYMQPTVFKGHNKMRIFQEEIFGPVLSVTTFKDDEEA
LSIANDTLYGLGAGVWTRDGTRAYRFGRAIQAGRVWTNCYHAYPAHAAFGGYKQSGIGRE
THKMMLDHYQQTKNMLVSYSSKKLGFF
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagcccgaattcctggcggatgccaagacgaagtcgccgttttcggcgcgctac
gacaacttcatcggcggccagtgggtcgcgccggcgagcggccgctacttcgagaacacc
tcccccatcaccggcaaggtgatctgcgaggtcgcccgctccgaggcggcggacatcgag
cgggcgctcgacgccgcgcacgccgccaaggatgcctggggccgcaccgcgccggccgag
cgcgcccgcatcctcaacaagatcgccgaccggatggaggacaacctcgatctgatcgcg
ctggccgagacctgggacaacggcaagccgatccgcgagaccaccgccgcggacatcccg
ctcgccatcgaccactggcgctacttcgccagctgcgtccgcgcccaggaaggcgcgatc
tccgagatcgaccacgacacggtggcctaccacttccacgagccgctcggcgtcgtcggc
cagatcatcccgtggaacttcccgatcctgatggcggtgtggaagctggcgcctgcgatc
gccgccggcaactgcgtggtgctcaagcccgccgagcagacccccgcctcgatcctcgtg
gtgatggagctgatcggcgacctgctgccgcccggcgtcatcaacgtcgtcaacggcttc
ggcttggaggccggcaagccgctcgcctcgaacccgcgcatcgccaagatcgccttcacc
ggtgagacgaccaccggccgcctcatcatgcagtacgcctcgcagaacctgatcccggtg
acgctggagctgggcggcaagtcgccgaacatcttcttcggggatgtcatcgacgaggat
gacgacttcttcgacaaggcgctcgaaggcttcaccatgttcgccctcaaccagggcgaa
gtctgcacctgcccgagccgcgcgctcgtgcacgagtcgatctacgaccgcttcatcgag
cgcgcgatcaagcgcgtcgaggcgatcacccagggctcgccgctcgatccggcgacgatg
atcggcgcgcaggcctcctcggagcagctcgagaagatcctcagctacgtcgatatcggc
cgccaggaaggcgccgagtgcctcacgggcggcgcccgcggcacccgcgagggcgatctg
gccgacggcttctacatgcagccgacggtgttcaagggccacaacaagatgcggatcttc
caggaggagatcttcgggcccgtcctctcggtgacgaccttcaaggacgacgaggaagcg
ctttcgatcgccaacgacacgctctacggcctcggcgccggcgtgtggacccgcgacgga
acccgcgcctaccgcttcggccgcgccatccaggccggtcgcgtctggacgaactgctac
cacgcctacccggcgcacgcggccttcggcggctacaagcagtccggcatcggccgtgag
acccacaagatgatgctcgaccactaccagcagaccaagaacatgctggtcagctactcc
tcgaagaagctcgggttcttctaa

DBGET integrated database retrieval system