KEGG   Methylobacterium extorquens CM4: Mchl_4394Help
Entry
Mchl_4394         CDS       T00809                                 

Definition
(GenBank) Glutathione S-transferase domain
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
mch  Methylobacterium extorquens CM4
Pathway
mch00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:mch00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Mchl_4394
Enzymes [BR:mch01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Mchl_4394
Transporters [BR:mch02000]
 Other Transporters
  Pores ion channels [TC:1]
   Mchl_4394
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C_2 GST_C Tom37
Motif
Other DBs
NCBI-ProteinID: ACK85170
UniProt: B7KN53
LinkDB All DBs
Position
complement(4643424..4644065)
Genome map
AA seq 213 aa AA seqDB search
MSDDLVFYTNPMSRGRIVRWMLEEVGAPYRTEILGYGSSMKAPAYRAINPMGKVPALRHG
ETVVTECPAILAYLADAFPQAGLAPAPGHHDRGPYYRWLFFCAGPLEAAVTNGVLKVSVP
DDPRMQGMVGYGSLEMALDTLEGAVSGVEFVAGDRFSAADLYVAAHLGWGMQFGTIPKRP
AFEAYAGRHLAREAAARARAIDDAFLAEAQAAS
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgtccgacgatctcgtcttctacaccaacccgatgtcccgcggccggatcgtccgctgg
atgctggaagaggtcggcgcgccctaccgcaccgagatcctcggctacggcagctctatg
aaggcgccggcataccgggcgatcaacccgatggggaaggtgccggcgctgcgccacggc
gagacggtggtgaccgagtgccccgcgatcctggcctatctcgccgacgccttcccgcag
gccgggctcgcccccgcgccgggccaccacgaccgcggcccctattatcgctggctgttc
ttctgcgccgggccgctcgaggcggcggtcacgaacggcgtgctcaaggtgagcgtcccc
gacgacccgcgcatgcagggcatggtcggctacggcagcctggagatggccctcgacacg
cttgaaggcgccgtctccggggtggagttcgtggcaggcgaccggttcagcgccgccgac
ctctacgtcgccgcacatctcggctggggcatgcagttcggtacgatcccgaagcgcccg
gccttcgaggcctatgccgggcgccacctcgcccgcgaggcggccgcgcgggcgcgggcg
atcgatgacgcttttctcgccgaggcgcaggcggcgtcatag

DBGET integrated database retrieval system